KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1945Help
Entry
NMB1945           CDS       T00027                                 

Gene name
ubiX
Definition
(RefSeq) aromatic acid decarboxylase
  KO
K03186  
flavin prenyltransferase [EC:2.5.1.129]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Aminobenzoate degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NMB1945 (ubiX)
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    NMB1945 (ubiX)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    NMB1945 (ubiX)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     NMB1945 (ubiX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2040448..2041020
Genome map
AA seq 190 aa AA seqDB search
MMVRRLIIGISGASGFQYGVKALELLRAQDVETHLVVSKGAEMARASETAYARDEVYALA
DFVHPIGNIGACIASGTFKTDGMLVAPCSMRTLASVAHGFGDNLLTRAADVVLKERRRLV
LMVRETPLNLAHLDNMKRVTEMGGVVFPPVPAMYRKPQTADDIVAHSVAHALSLFGIDTP
DSAEWQGMAD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacggcgtttgataatcggcatcagcggggcgagcggtttccaatacggcgtg
aaggctttggaacttttgcgcgcgcaagatgtcgaaacgcaccttgtggtatcgaaaggt
gcggagatggcgcgcgcttcggaaacggcttatgcgagagacgaggtatatgccttggcg
gacttcgtgcatccgatcggcaatatcggggcgtgcattgccagcggtacgtttaaaacg
gatgggatgctggtcgccccctgttcgatgcggacgcttgcctctgtcgcgcacggcttc
ggcgacaatctgctgacgcgtgcggcggatgtggttttgaaggaaaggcggcggctggtg
ctgatggtgcgcgaaacgccgctgaaccttgcccatttggacaatatgaagcgggtaacg
gaaatgggcggcgtggtgtttccccctgttcctgcgatgtaccgcaaaccgcagacggcg
gacgacatagtggcgcacagtgttgcacacgctttgtcgctgttcggaatcgatacgccg
gattcggcggaatggcagggaatggcggattaa

DBGET integrated database retrieval system