KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1946Help
Entry
NMB1946           CDS       T00027                                 

Definition
(RefSeq) outer membrane lipoprotein
  KO
K02073  
D-methionine transport system substrate-binding protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
ABC transporters
Module
D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:nme00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    NMB1946
Transporters [BR:nme02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    NMB1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2041082..2041945)
Genome map
AA seq 287 aa AA seqDB search
MKTFFKTLSAAALALILAACGGQKDSAPAASASAAADNGAAKKEIVFGTTVGDFGDMVKE
QIQAELEKKGYTVKLVEFTDYVRPNLALAEGELDINVFQHKPYLDDFKKEHNLDITEVFQ
VPTAPLGLYPGKLKSLEEVKDGSTVSAPNDPSNFARVLVMLDELGWIKLKDGINPLTASK
ADIAENLKNIKIVELEAAQLPRSRADVDFAVVNGNYAISSGMKLTEALFQEPSFAYVNWS
AVKTADKDSQWLKDVTEAYNSDAFKAYAHKRFEGYKSPAAWNEGAAK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccttcttcaaaaccctttccgccgccgcactcgcgctcatcctcgccgcctgc
ggcggtcaaaaagacagcgcgcccgccgcatccgcttctgccgccgccgacaacggcgcg
gcgaaaaaagaaatcgtcttcggcacgaccgtcggcgacttcggcgatatggtcaaagaa
caaatccaagccgagctggagaaaaaaggctacaccgtcaaactggtcgagtttaccgac
tatgtacgcccgaatctggcattggctgagggcgagttggacatcaacgtcttccaacac
aaaccctatcttgacgacttcaaaaaagaacacaatctggacatcaccgaagtcttccaa
gtgccgaccgcgcctttgggactgtacccgggcaagctgaaatcgctggaagaagtcaaa
gacggcagcaccgtatccgcgcccaacgacccgtccaacttcgcccgcgtcttggtgatg
ctcgacgaactgggttggatcaaactcaaagacggcatcaatccgttgaccgcatccaaa
gcggacatcgccgagaacctgaaaaacatcaaaatcgtcgagcttgaagccgcgcaactg
ccgcgtagccgcgccgacgtggattttgccgtcgtcaacggcaactacgccataagcagc
ggcatgaagctgaccgaagccctgttccaagaaccgagctttgcctatgtcaactggtct
gccgtcaaaaccgccgacaaagacagccaatggcttaaagacgtaaccgaggcctataac
tccgacgcgttcaaagcctacgcgcacaaacgcttcgagggctacaaatcccctgccgca
tggaatgaaggcgcagccaaataa

DBGET integrated database retrieval system