KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1955Help
Entry
NMB1955           CDS       T00027                                 

Definition
(RefSeq) cadmium resistance protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2050348..2050974)
Genome map
AA seq 208 aa AA seqDB search
MRCFMIQNVVTSIILYSGTAVDLLIILMLFFAKRKSRKDIINIYLGQFLGSVSLILLSLL
FAFVLDYIPSKEILGLLGLIPILLGIKVLLLGDSDGEAIAKEGLRKDNKNLIFLVAMITF
ASCGADNIGVFVPYFTTLNLANLIVALLTFLVMIYLLVFSAQKLAQVPSVGETLEKYSRW
FVAVVYLGLGIYILVENNSFDMLWTVLG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagatgttttatgattcaaaatgtcgttacttcaataatcctgtattctgggacagcc
gtagacttacttattatcctaatgttattttttgccaaaagaaaaagtagaaaagacatc
attaacatctatttaggacaatttctaggctctgttagtctgatattgctaagtttactt
tttgcatttgtcttagattatattcctagtaaagagattttaggtttgctcggcttgatt
ccaattctcctaggcatcaaagttttgcttttaggagattctgatggagaggctattgcc
aaagagggtttgcgcaaagataataaaaacctgatttttctagtcgctatgattactttt
gcaagttgtggtgctgacaatattggtgtctttgtcccatattttactaccttaaattta
gcgaatttgatagtggctttacttacctttctagtcatgatttatctcttggttttttct
gcccaaaaattagcacaagtcccttctgttggagaaactttggaaaaatatagcagatgg
tttgttgctgttgtttatttaggattggggatatatatcctggttgaaaacaacagtttt
gatatgctatggactgtgttgggctag

DBGET integrated database retrieval system