KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1968Help
Entry
NMB1968           CDS       T00027                                 

Gene name
aldA
Definition
(RefSeq) aldehyde dehydrogenase
  KO
K07248  
lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB1968 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    NMB1968 (aldA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     NMB1968 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     NMB1968 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2058977..2060419
Genome map
AA seq 480 aa AA seqDB search
MKQLAMYINGRFENDFNGEWRDVLNPSTEEAIAREPKGGKADVDRAVAAARAAQPAWERL
PAVERGAYLRKIAQGIRERADELTDTIVAEGGKTKDLARVEVMFTADYLDYQAEWARRYE
GEIIQSDRPRENILLFKRPLGVIAGILPWNFPFFLIARKMGPALVTGNTIVVKPSSVTPI
NCHIFAEIVDAVGLPAGVFNVVNGPGAEIGNALSAHPQVDMVSLTGSVEAGRQVMEAASA
NITKVSLELGGKAPAIVLKDADLDLAVKSILASRVGNTGQICNCAERVYVHSSLKDAFIE
KMTAAMKGVRYGNPAEAEAGALEMGPLIEERAVKAVAEKVERAVKQGAKLVCGGKRAEGR
GYFFEPTLLTDTDNSMDIMKEETFGPVLPVSAFDTLDQVIALANDCEFGLTSSVYTTNLN
EAFYVTRRLQFGETYINRENFEAMQGFHAGWKKSGIGGADGKHGLEEYLQTQVVYLETDI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattggccatgtacatcaacggacgctttgaaaacgatttcaacggcgaatgg
cgcgacgtattgaacccgtccaccgaagaggccatcgcccgcgaacccaaaggcggcaag
gcggacgttgaccgcgccgtcgcggcggcgcgtgcggcgcaaccggcttgggagcgtctg
cctgcggtcgaacgcggcgcgtatttgcgtaaaatcgcccaaggcatacgcgaacgtgcc
gacgagctgaccgacaccatcgttgccgaaggcggcaaaaccaaagacttggcacgcgtg
gaagtcatgttcaccgccgactatctcgattatcaggccgaatgggcgcgccgctacgaa
ggcgaaatcatccaaagcgaccgcccgcgcgaaaatattttattgttcaaacgtccgctg
ggcgtaattgccggcattttgccgtggaacttccccttcttcctgattgcccgcaaaatg
ggccccgctttggtaacgggcaacaccatcgtcgtcaaacccagcagcgtaaccccgatc
aactgccacatcttcgccgaaatcgtcgatgcggtcggactgcccgcaggcgtgttcaac
gtggtgaacggtcccggcgcggaaatcggcaatgccttgtccgcccatccgcaagtcgat
atggtcagcctgaccggctccgtcgaagcaggccgccaagtgatggaagccgcctccgcc
aacatcaccaaagtttcgctggaactcggcggcaaagcgcctgccatcgttttgaaagat
gcggatttggacttggcggtgaaatccatcttggcttcgcgcgtcggcaacaccggtcaa
atctgcaactgcgccgagcgcgtctatgtccacagcagtctgaaagacgcattcattgaa
aaaatgaccgccgcgatgaaaggcgtgcgctacggcaaccctgccgaagccgaagcaggc
gcgctggaaatgggcccgctgattgaagaacgcgccgtcaaagccgttgccgaaaaagtg
gaacgggcagtcaaacaaggtgcgaaattggtttgcggcggcaaacgcgccgaaggacgc
ggttatttcttcgagccgaccctgctgaccgacaccgacaacagtatggacattatgaaa
gaagaaaccttcggccccgtgctgcccgtttccgctttcgacacgctcgaccaagtcatc
gccttggcaaacgattgcgagtttggtctgaccagttctgtttatacgactaatttaaac
gaagccttctacgttacccgccgcctgcaattcggcgaaacctacatcaaccgcgaaaac
tttgaagcgatgcagggtttccacgccggttggaaaaaatccggtatcggcggcgcggac
ggcaaacacggtttggaagaatatctgcaaacccaagtcgtttatttggaaaccgacatt
taa

DBGET integrated database retrieval system