KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1976Help
Entry
NMB1976           CDS       T00027                                 

Gene name
lysA
Definition
(RefSeq) diaminopimelate decarboxylase
  KO
K01586  
diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB1976 (lysA)
  Amino acid metabolism
   00300 Lysine biosynthesis
    NMB1976 (lysA)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     NMB1976 (lysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2074556..2075800)
Genome map
AA seq 414 aa AA seqDB search
MTLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAALNPLVCYAVKANGNLSII
KHFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIP
EIDRIQKVAARLGKTAPVSLRINPDVDAKTHPYISTGLKANKFGIAYADALEAYHYAAQQ
PNLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQDEN
VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN
DLMRPALYDAYHHIEAVETKDIATLTANIVGPICETGDFLGKDRTIACEEGDLLLIRSAG
AYGASMASNYNARNRAAEVLVDGNEYRLIRRRETLEQQMANELACLQAEHQNAV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaccctattttgcgaacaagtcccctacccccgccttgctgaagcattcggcacaccg
ctttatgtgtacagccaatccgcgctgaccgaagcatttgaacactaccaaaccgcgttt
gccgctttgaacccgctcgtctgttacgccgtcaaggcaaacggcaatctgagcattatc
aaacacttcgcctcgctgggcagcggttttgacattgtgtccggcggcgaattggcacgc
gttttggcggcaggcggcgacgcggcaaaaaccatattttcaggcgtaggcaaaagcgag
gcggaaatcgagttcgcgctgaatgcaggcgtgaaatgcttcaatatggaaagcatcccc
gaaatcgaccgtattcagaaagttgccgcacgtttgggtaaaaccgcgcccgtctccctg
cgcatcaaccccgatgtcgatgcaaaaacccatccctacatctccacaggtctgaaagcc
aacaaattcggcatcgcctacgccgacgcgctcgaagcctaccactatgccgcacaacag
cccaatttgaaaatcatcggcatcgactgccacatcggttcgcaactgaccgacttaagc
ccgctggtcgaagcctgcgagcgcattttgattttggttgacgcgcttgccgccgaaggc
attgttttggaacatttagacttaggcggcggcgtcggcattgtttaccaagacgaaaat
gtgcctgatttgggcgcgtatgcccaagccgttcaaaaactgatcggcacacgccgtctg
aaactcattcttgagcccggccgcagcctggtcggcaacgcaggttcgctgctgacacgc
gtcgagtttgtcaaatacggcgaagagaaaaactttgtgatggtcgatgcggcgatgaac
gatttgatgcgcccggcgctttatgatgcctatcatcacatcgaggcggtcgaaaccaaa
gacatcgcgacgctgaccgccaacatcgtcggtccgatttgcgaaaccggcgacttcctc
ggcaaagaccgcaccatcgcctgcgaagaaggggatttgctgcttatccgcagcgcgggc
gcatacggggccagtatggcgagcaattacaacgcgcgcaaccgtgcggcagaggtgttg
gtggacggcaacgaataccgactcatccgccggcgcgaaaccttggaacagcaaatggca
aacgaactcgcctgcctgcaagccgaacatcaaaatgccgtctga

DBGET integrated database retrieval system