KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1981Help
Entry
NMB1981           CDS       T00027                                 

Definition
(RefSeq) S-ribosylhomocysteinase
  KO
K07173  
S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of amino acids
Quorum sensing
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB1981
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB1981
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NMB1981
Enzymes [BR:nme01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     NMB1981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2077885..2078391
Genome map
AA seq 168 aa AA seqDB search
MPLLDSFKVDHTRMHAPAVRVAKTMTTPKGDTITVFDLRFCVPNKEILPGKGIHTLEHLF
AGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWLASMQDVLNVKDQSKI
PELNEYQCGTYQMHSLAEAQQIAQNVLARKVAVNKNEELTLDEGLLNA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcccctactagacagtttcaaagtcgatcacacccgtatgcatgcccccgccgtacgc
gtggcgaaaaccatgactacgcccaaaggcgacaccattaccgtgtttgacctgcgcttt
tgcgttcccaacaaagaaatcctgcctggaaaaggcatacacacgctggagcatttgttc
gcaggttttatgcgcgaccacttgaacggcaacggcgtggaaatcatcgacatttccccg
atgggctgccgcaccggtttttatatgagtcttatcggcacgccttccgaacagcaggtc
gccgatgcgtggctggcttcgatgcaggatgttttgaatgtcaaagaccaaagcaaaatc
cccgagttgaacgaataccaatgcggcacttatcaaatgcactcgctcgccgaagcgcag
caaatcgcgcaaaacgtgttggcgcgcaaagtggcggtgaacaaaaatgaagagctgacg
ctggatgaagggctgctgaacgcctaa

DBGET integrated database retrieval system