KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1996Help
Entry
NMB1996           CDS       T00027                                 

Gene name
purL
Definition
(RefSeq) phosphoribosylformylglycinamidine synthase
  KO
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB1996 (purL)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     NMB1996 (purL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2102032..2105994
Genome map
AA seq 1320 aa AA seqDB search
MSVVLPLRGVTALSDFRVEKLLQKAAALGLPEVKLSSEFWYFVGSEKALDAATVEKLQAL
LAAQSVEQTPKAREGLHLFLVTPRLGTISPWASKATNIAENCGLAGIERIERGMAVWLEG
RLNDEQKQQWAALLHDRMTESVLPDFQTASKLFHHLESETFSGVDVLGGGKEALVKANTE
MGLALSADEIDYLVENYQALQRNPSDVELMMFAQANSEHCRHKIFNADFILNGEKQPKSL
FGMIRDTHNAHPEGTVVAYKDNSSVIEGAKIERFYPNAAENQGYRFHEEDTHIIMKVETH
NHPTAIAPFAGAATGAGGEIRDEGATGKGSRPKAGLTGFTVSNLNIPDLKQPWEQDYGKP
EHISSPLDIMIEGPIGGAAFNNEFGRPNLLGYFRTFEEKFDGQVRGYHKPIMIAGGLGSI
QAQQTHKDEIPEGALLIQLGGPGMLIGLGGGAASSMDTGTNDASLDFNSVQRGNPEIERR
AQEVIDRCWQLGGKNPIISIHDVGAGGLSNAFPELVNDARRGAVFKLREVPLEEHGLNPL
QIWCNESQERYVLSILEKDLDAFRAICERERCPFAVVGTATDDGHLKVRDDLFANNPVDL
PLNVLLGKLPKTTRTDKTVAPSKKPFHAGDIDITEAAYRVLRLPAVAAKNFLITIGDRSV
GGLTHRDQMVGKYQTPVADCAVTMMGFNTYRGEAMSMGEKPTVALFDAPASGRMCVGEAI
TNIAAVNIGDIGNIKLSANWMAACGNEGEDEKLYRTVEAVSKACQALDLSIPVGKDSLSM
KTVWQDGEEKKSVVSPLSLIISAFAPVKDVRKTVTPELKNVEDSVLLFVDLGFGKARMGG
SAFGQVYNNMSGDAPDLDDTGRLKAFYSVIQQLVAENKLLAYHDRSDGGLFAVLVEMAFA
GRCGLDIDLNLLLAQTFITNHTALSQSLRTEEVKALAEWQETIARTLFNEELGAVIQVRK
QDVADIINLFYQQQLHHNVFEIGTLTDENTLIIRDGQTHLISDNLIKLQQTWQETSHQIQ
RLRDNPACADSEFALIGDNERSALFADVKFDVNEDIAAPFINSGAKPKIAILREQGVNGQ
IEMAAAFTRAGFDAYDVHMSDLMAGRIHLADFKMLAACGGFSYGDVLGAGEGWAKSILFH
PALRDQFAAFFADPDTLTLGVCNGCQMVSNLAEIIPGTAGWPKFKRNLSEQFEARLSMVH
VPKSASLILNEMQGSSLPVVVSHGEGRADFALHGGNISADLGIALQYIDGQNQVTQTYPL
NPNGSPQGIAGVTNADGRITIMMPHPERVYRAAQMSWKPEGWTELSGWYRLFAGARKALG
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgttttgcccttgcgcggcgttaccgccctttccgatttccgtgttgaaaaa
ctcttgcaaaaagccgccgcactcggtctgcccgaagtcaaattaagcagcgaattttgg
tatttcgtcggcagcgagaaagcacttgatgccgcgactgtcgaaaaactgcaagccttg
ttggcggcgcaaagcgttgaacaaacgccaaaagcgcgcgagggcttgcatttgtttttg
gtcacgccccgtttgggtacgatttcgccgtgggcttccaaggcgaccaatatcgcggaa
aactgcggtttggcaggcatcgaacgcatcgagcgcggtatggcggtgtggctggaaggt
cgtctgaacgatgaacagaaacagcaatgggcggctttgctgcacgaccgcatgaccgaa
agcgtgctgcccgattttcagacggcctccaaattattccaccatctcgaatccgaaact
ttctccggcgtcgatgttttgggcggcggtaaagaagctttggtcaaagccaataccgaa
atgggcttggcactttccgccgacgaaatcgattatctggtcgaaaactatcaggctttg
cagcgcaatccgtccgatgttgaattgatgatgttcgcgcaggcaaacagcgaacactgc
cgccacaaaatcttcaacgccgatttcatcctcaacggcgaaaagcagcccaaatccctc
ttcggtatgatacgcgacacacacaacgcgcatcccgaaggcacggtcgttgcctataaa
gacaattcgtccgtaatcgaaggcgcgaaaatcgagcgtttctatccgaatgcggcggaa
aaccaaggctaccgtttccacgaggaagacacgcatatcatcatgaaagtggaaacgcac
aaccacccgaccgccatcgcgccgtttgcgggtgcggcgacgggcgcgggcggcgaaatc
cgcgacgaaggcgcgacgggcaaaggttcgcgtccgaaagcgggcctgaccggctttacc
gtgtccaacctcaatattcccgacctcaaacagccgtgggaacaagactacggcaagccg
gaacatatttcctcgccgctggacatcatgattgaaggcccgatcggcggcgcggcgttc
aacaacgaattcggccgccccaacctcttgggctacttccgcacttttgaagaaaaattt
gacggtcaggttcgcggctatcacaaaccgattatgattgccggcggcttgggcagcatt
caggcgcagcagacgcataaagacgaaatccccgaaggcgcattgctgatccaactgggc
ggcccgggtatgcttatcggcttgggcggcggcgcggcttcttcgatggataccggcaca
aacgacgcgtctttggacttcaactccgtgcaacgcggcaaccccgaaatcgaacgccgc
gcgcaggaagtcatcgaccgctgctggcagctcggcggcaaaaacccgattatctccatc
cacgacgtaggcgcgggcggcctgtccaacgccttccccgaactggtcaacgatgccaga
cgcggcgcagtattcaagctgcgcgaagtgccgcttgaagaacacggcctcaacccgctg
caaatctggtgcaacgaatcgcaagagcgttatgtgttgtcgattttggaaaaagatttg
gatgctttccgcgccatctgcgaacgcgaacgctgcccgtttgccgtagtcggcacggcg
actgacgacggtcatttgaaagtacgcgacgatttgttcgccaacaatcccgtcgatttg
ccgttgaacgtcttgctcggcaaactgcccaaaaccacgcgcaccgacaaaacggttgca
ccgtccaaaaaaccgtttcacgcgggcgatatcgacattaccgaagccgcctaccgcgtt
ttgcgcctgcctgccgtagccgccaaaaacttcctgattaccatcggcgaccgcagcgtc
ggcggtttgacgcaccgcgaccaaatggtcggcaaatatcaaactccagtagccgactgc
gccgttaccatgatgggcttcaacacctatcgcggtgaagcgatgtctatgggcgaaaaa
ccgaccgtcgccctgtttgatgcgcctgcttcgggcagaatgtgcgtcggcgaagccatc
accaacatcgcggcggtcaacatcggagacatcggcaacatcaaactctccgccaactgg
atggcggcgtgcggcaacgaaggcgaagacgaaaaactctaccgcactgtcgaagccgtt
tccaaagcctgtcaggcattggatttgagcatccccgtgggcaaagacagcctgtcgatg
aaaaccgtttggcaggacggcgaggagaaaaaatccgtggtttcaccgttgagcctgatt
atctcagcgttcgcgcctgtgaaagacgtacgcaagactgttacgcctgagttgaaaaac
gtcgaagacagcgtattgttgtttgtcgatttgggcttcggcaaagcgcgtatgggcggt
tcggcgtttggtcaggtgtacaacaatatgagcggcgacgcgcccgatttggacgataca
ggtcgtctgaaagccttttacagtgtgattcagcagcttgttgccgaaaacaaactcttg
gcgtatcacgaccgcagcgacggcggcttgtttgccgttttggtagaaatggcgtttgcg
gggcggtgcggcttggatatagatttaaatttattgcttgcacaaacatttattaccaac
cataccgctctgtctcaatcattgcggactgaagaggtaaaagcgttggctgaatggcaa
gaaaccattgcccgcacattatttaatgaagagttgggtgctgttatccaagttagaaaa
caagatgttgccgatattatcaatttattctatcaacaacagctgcatcataatgtcttt
gaaatcggtacgttaactgatgagaacacgttaatcatccgcgacgggcaaacgcacctt
atttctgacaacctaatcaaactgcaacaaacctggcaagaaaccagccatcaaatccaa
cgcctgcgcgacaaccctgcctgcgccgacagcgagttcgcactgattggcgacaacgaa
cgcagcgcattgtttgccgacgtgaagttcgacgtgaacgaagacatcgccgcgccgttt
atcaacagcggcgcgaaacccaaaatcgccatcctgcgcgaacagggcgtaaacgggcaa
atcgaaatggccgccgcctttacccgcgccggattcgatgcttacgacgtgcatatgtcc
gacctgatggcaggccgcatccacctcgccgacttcaaaatgctggcggcgtgcggcggc
ttcagctacggcgacgtactcggcgcgggcgaaggctgggcgaaatcgattctgttccac
cctgctctgcgcgaccagtttgccgccttcttcgccgacccggacacgctgacattgggc
gtgtgcaacggctgccaaatggtcagcaaccttgccgaaatcatccccggcacggcaggc
tggccgaagttcaaacgcaacctgagcgaacagtttgaagcacgcctgagcatggttcac
gttccgaaatcagcgtcgctgattctgaacgaaatgcaaggctccagcctgcctgtcgtg
gtcagccacggcgaaggccgcgccgacttcgcgcttcacggcggcaatatttccgccgat
ttgggcattgcgctgcaatacatcgacggacaaaaccaagtgacccaaacttatccgctc
aaccccaacggctcgcctcaaggcatcgccggcgttactaacgccgacggccgcatcacc
atcatgatgccccaccccgaacgcgtgtaccgtgccgcgcaaatgagctggaaaccggaa
ggctggacggaactgtccggctggtaccgcctctttgccggcgcacgtaaagccttgggc
taa

DBGET integrated database retrieval system