KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1997Help
Entry
NMB1997           CDS       T00027                                 

Gene name
gloB
Definition
(RefSeq) hydroxyacylglutathione hydrolase
  KO
K01069  
hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB1997 (gloB)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     NMB1997 (gloB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2106089..2106847
Genome map
AA seq 252 aa AA seqDB search
MKITPVKALTDNYIWMIQHGNHAVCVDPSEPSPVLEFLVRNRLMLAQTWVTHPHPDHEGG
AAALWRGYMESPVYGESDIEAATHTVTAGTQFTFGDGQVTVWATPGHTDRHTSYLLETSD
GIHVFCGDTLFSAGCGRVFTGTIEQLYDSFQRFNRLPENTLFYPAHEYTAANLRFAAHIE
PDNADIQTALKAAAHTPTLPVTLAHERRVNPFLRVDLPHVRDRAEALSGKTLNSSLDTFV
ALRELKNQYRTK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacccccgtcaaagccctaaccgacaactacatctggatgatacagcacggc
aaccatgccgtctgcgtcgacccttccgaaccctcgcccgtcttggaattcctcgtccgc
aaccgcctcatgcttgcccaaacatgggtaactcacccccatcccgaccacgagggcggt
gcggcggcactctggcgcggctacatggaatcgcccgtttacggcgaatccgacatcgaa
gcagcaacccacaccgtaaccgccggcacccaattcaccttcggcgacggacaggttacc
gtttgggcaacacccggccacacagaccgccacaccagctaccttctcgaaacttcagac
ggcatacacgtcttttgcggcgacacccttttttccgccggctgcggacgcgtgtttacc
ggcacaatcgaacagctttacgacagcttccaacgcttcaaccgcctgcctgaaaacacc
ctgttctatccggcgcacgaatacaccgccgccaacctgcgtttcgccgcccatatcgag
ccggacaacgccgacattcagacggcactgaaagcggcggcgcatacgcctaccctgccc
gttaccctcgcgcacgaacgccgcgtcaatccgtttttgcgcgtcgacctgccgcacgtc
agagaccgcgccgaggcattgagcgggaaaacgttaaacagcagcctcgatacctttgtc
gcgctgcgtgaacttaaaaaccaataccggacgaaataa

DBGET integrated database retrieval system