KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1999Help
Entry
NMB1999           CDS       T00027                                 

Gene name
mgtE
Definition
(RefSeq) magnesium transporter
  KO
K06213  
magnesium transporter
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Pores ion channels [TC:1]
   NMB1999 (mgtE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2111688..2113142
Genome map
AA seq 484 aa AA seqDB search
MSIEPTPPNLENDGIENDVERVSADFDRVHSLCEILEPAFEQIENGTPLEDAPLRDKLTE
LTVLLSELHPADVAAVLESLPPRERNIVWILVKPEDDGEVLLEVSDAVRETLIESMDKDE
LLAAVDDLDADELAELADDLPHQVVYEALQTRDEEERAQVKAAMSYEDNQVGAIMDFELV
SIRADVACEVVLRYLRRFDSLPDHTDKIFVVDENDVLQGVLPIRKLLVADPEDLVENVMA
KDVVRFRAEDDVEEAAQAFERYDLVTAPVVDENKKLIGRITIDEMVDVIREESEADMLNM
AGLQEEEDLFAPVWDSVKNRWMWLAVNLCTAFLASRVIGAFEGSIEKIVALAALMPIVAG
IGGNSGNQTITMIVRAMAMGQLTDMQAGRLLKKEVGVALVNGIIWGTVMGAVSWLLYGSL
GIGLVMIAAMTLNLLLAATVGVLIPVVMEKFGRDPALGSSVLITAVTDSGGFLIFLGLAT
LFLL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaaccaacccctccgaaccttgaaaacgacggtatcgaaaacgatgtagaa
cgcgtttccgccgatttcgaccgtgtccactccctctgcgaaatcctcgaacctgctttt
gaacaaatcgaaaacggtacaccgctcgaagacgcgccgctgcgcgacaagctgaccgag
ctgaccgtcctcttgagcgagctgcaccctgccgacgtggcggcggtattggaatcgcta
ccgccgcgcgaacgcaatatcgtctggattctggtcaaaccggaagacgacggcgaagta
ttgctggaagtatccgacgcggtgcgcgaaacgctgatcgagtcgatggacaaagacgaa
ttgttggcagcggtcgatgatttggacgcggacgaattggcggaactggcagacgatttg
ccgcaccaagtggtttacgaagcgctacaaacccgcgatgaggaagaacgcgcccaagtc
aaagcggcaatgtcctacgaagacaaccaagtcggtgcgattatggacttcgagttggtc
agcatccgcgccgatgtcgcctgtgaagtggtgctgcgctatctgcgccgcttcgacagc
ctgcccgaccataccgacaagatttttgtggtcgatgaaaacgacgtactgcagggcgtg
ctgcccatccgcaaacttttggtcgccgatcccgaagacttggtggaaaacgtgatggcg
aaagatgtcgtgcgtttccgcgccgaagatgacgtggaagaagcggcgcaggcgtttgaa
cgctacgacttggttaccgcgcccgtcgtcgatgaaaacaaaaagctcatcggcaggatt
accatcgacgagatggtggacgtgatccgcgaagaatcggaagcggatatgctgaatatg
gcgggtttgcaggaagaggaagacctgttcgcccccgtgtgggattcggtgaaaaaccgc
tggatgtggctcgccgtcaacctctgcaccgccttcctcgccagccgtgttatcggcgcg
tttgaaggcagcatcgaaaaaatcgtcgcactcgccgcgctgatgcccatcgtcgccggc
ataggcggtaactcgggcaaccagacgattaccatgattgtccgcgcgatggcgatgggg
cagctgacggatatgcaggcggggcgtttgctgaaaaaagaagtcggtgtcgccttggtc
aacggcatcatttggggaacggtcatgggcgcagtatcttggctgctttacggcagcctc
ggcatcgggctggttatgattgccgcgatgacgctcaacctcctgctggcggcaaccgtc
ggcgtattaattcccgtggtaatggaaaagttcggacgcgatcccgcactgggcagctcg
gtgctgattaccgccgttaccgactccggcggcttcctgattttcttggggctcgccacc
ctattcctgctttaa

DBGET integrated database retrieval system