KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2010Help
Entry
NMB2010           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2123116..2124693
Genome map
AA seq 525 aa AA seqDB search
MMKKSFLTLVLYSSLLTASEIAYRFVFGIETLPAAKIAETFALTFVIAALYLFARYKVTR
LLIAVFFAFSIIANNVHYAVYQSWMTGINYWLMLKEVTEVGSAGASMLDKLWLPVLWGVL
EVMLFCSLAKFRRKTHFSADILFAFLMLMIFVRSFDTKQEHGISPKPTYSRIKANYFSFG
YFVGRVLPYQLFDLSRIPAFKQPAPSKIGQGSVQNIVLIMGESESAAHLKLFGYGRETSP
FLTRLSQADFKPIVKQSYSAGFMTAVSLPSFFNAIPHANGLEQISGGDTNMFRLAKEQGY
ETYFYSAQAENEMAILNLIGKKWIDHLIQPTQLGYGNGDNMPDEKLLPLFDKINLQQGKH
FIVLHQRGSHAPYGALLQPQDKVFGEADIVDKYDNTIHKTDQMIQTVFEQLQKQPDGNWL
FAYTSDHGQYVRQDIYNQGTVQPDSYLVPLVLYSPDKAVQQAANQAFAPCEIAFHQQLST
FLIHTLGYDMPVSGCREGSVTGNLITGDAGSLNIRDGKAEYVYPQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaatctttccttacgcttgttctgtattcgtctttacttaccgccagcgaa
attgcctatcgctttgtatttgggattgaaaccttaccggcggcaaaaattgcggaaacg
tttgcgctgacatttgtgattgctgcgctgtatctgtttgcgcgttataaggtgacgcgt
ttgttgattgcggtgttttttgcgttcagcattattgccaacaatgtgcattacgcggtt
tatcaaagctggatgacgggcatcaattattggctgatgctgaaagaggttaccgaagtc
ggcagcgcgggtgcgtcgatgttggataagttgtggctgcctgtgttgtggggcgtgttg
gaagtcatgttgttttgcagccttgccaagttccgccgtaagacgcatttttctgccgat
atactgtttgccttcctaatgctgatgattttcgtgcgttcgttcgacacgaaacaagag
cacggtatttcgcccaaaccgacatacagccgcatcaaagccaattatttcagcttcggt
tattttgtcggacgcgtgttgccgtatcagttgtttgatttaagcaggattcccgccttt
aagcagcctgctccaagcaaaatcgggcagggcagtgttcaaaatatcgtcctgattatg
ggcgaaagcgaaagcgcggcgcatttgaagctgtttggctacggacgcgaaacttcgccg
tttttaacccggctgtcgcaagccgattttaagccgattgtgaaacaaagttattccgca
ggctttatgactgcagtgtccctgcccagttttttcaatgcgataccgcacgccaacggc
ttggaacaaatcagcggcggcgataccaatatgttccgcctcgccaaagagcagggctat
gaaacgtatttttacagcgcgcaggcggaaaacgagatggcgattttgaacttaatcggt
aagaaatggatagaccatctgattcagccgacgcaacttggctacggcaacggcgacaat
atgcccgatgagaagctgctgccgttgttcgacaaaatcaatttgcagcagggcaagcat
tttatcgtgttgcaccaacgcggttcgcacgccccatacggcgcattgttgcagcctcaa
gataaagtattcggcgaagccgatattgtggataagtacgacaacaccatccacaaaacc
gaccaaatgattcaaaccgtattcgagcagctgcaaaagcagcctgacggcaactggctg
tttgcctatacctccgatcatggccagtatgttcgccaagatatctacaatcaaggcacg
gtgcagcccgacagctatctcgtgccgctagtgttgtacagcccggataaggccgtgcaa
caggctgccaaccaggcttttgcgccttgcgagattgccttccatcagcagctttcaacg
ttcctgattcacacgttgggctacgatatgccggtttcaggttgtcgcgaaggctcggta
acgggcaacctgattacgggtgatgcaggcagcttgaacattcgcgacggcaaggcggaa
tatgtttatccgcaatga

DBGET integrated database retrieval system