KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2019Help
Entry
NMB2019           CDS       T00027                                 

Gene name
coaD
Definition
(RefSeq) phosphopantetheine adenylyltransferase
  KO
K00954  
pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB2019 (coaD)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     NMB2019 (coaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2138479..2138991)
Genome map
AA seq 170 aa AA seqDB search
MLPNTPRRAVYAGSFDPPTLGHLWMIRQAQSMFDELIVAIGINPDKRSTYTVAERQDMLC
DITKMFPNVRTDVFENRFLVHYAREVDAGFIVRGIRSASDYEYERSMRHINSDLAPEIST
VFLMPPREIAEVSSTMVKGLVGPEGWTETIHRYVPQAVYEKILAEHQHEN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgttaccgaatacaccgcgccgcgccgtttatgccggcagtttcgatccgcccacattg
gggcatctgtggatgatacggcaggcgcaatctatgtttgacgaactcatcgtcgccatc
ggcattaaccccgacaaacgcagcacctataccgtcgctgaaaggcaggatatgttgtgc
gatattactaaaatgtttcccaacgtcagaaccgatgtatttgaaaaccgatttctggtg
cattacgcccgtgaggtagatgcaggattcatcgtgcgcggcatccgttctgcttcggat
tacgaatacgaacgttccatgcgccatatcaacagcgacctcgcccccgaaatatccacc
gtattcctcatgccgccgcgcgaaatcgccgaagtgtcgtccactatggtcaaaggactg
gtcgggccggaaggctggacggaaacgatccaccgctacgtgccgcaagctgtgtacgaa
aaaatccttgccgaacatcaacacgaaaattga

DBGET integrated database retrieval system