KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2024Help
Entry
NMB2024           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K00969  
nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB2024
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     NMB2024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2141263..2141868)
Genome map
AA seq 201 aa AA seqDB search
MKKIGLFGGTFDPIHNGHLHIARAFADEIGLDAVVFLPTGGPYHKDAASASAADRLAMVE
LATAEDARFAVSDCDIVREGATYTFDTVQIFRQQFPSAQLWWLMGSDSLMKLHTWKKWQM
LVRETNIAVAMRQGDSLHQTPRELHAWLGKSLQDGSVRILSAPMHNVSSTEIRRNLAGQG
VSDGIPPAAARYIREHGLYEK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcggattgttcggcggtactttcgacccgatacacaacggacatcttcat
atcgcccgtgcctttgccgacgaaatcggcttggacgcggttgttttcctgccgacaggc
ggcccgtatcacaaagacgcagcctccgcttccgccgccgaccgccttgccatggtcgaa
ttggcgacggcagaagacgcgcgttttgccgtcagcgattgcgacatcgtccgagaaggt
gcaacctatacttttgataccgtccaaatcttccgccagcagttcccatccgcgcaactc
tggtggctgatgggcagcgacagcctgatgaagctgcacacatggaaaaaatggcagatg
ctcgtgcgcgaaaccaatatcgccgtcgccatgaggcagggcgacagcctgcaccaaacc
ccgcgcgaactgcacgcgtggctgggcaagtcccttcaggacggcagcgtccgcatcttg
tccgccccgatgcataatgtgtcgtcaacggaaatccgccgcaaccttgccggccaaggc
gtttcagacggcatcccgcctgccgccgcacgctacatccgcgaacacggtttgtatgaa
aaataa

DBGET integrated database retrieval system