KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2025Help
Entry
NMB2025           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K01673  
carbonic anhydrase [EC:4.2.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    NMB2025
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     NMB2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2141865..2142464)
Genome map
AA seq 199 aa AA seqDB search
MSELDNILAHNRQFVESGEYEKYFTDKYPERGLAVLSCMDARIIGLLPDALGLKNGDAKL
IKNAGALVTHPWGSVMRSLLVAVFELKVREIMVIAHHDCGMQGLNAEEFLGRVRESRIPE
DRIETLRYAGIDLDGWLTGFDNVEDSVRHTVDLIRNHPLMPRHIAVHGLVIHPVTGKLTL
VVDGSVSDGMDLSEGMETS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagttggataacatccttgcccataaccggcagtttgtcgagtcgggcgaatat
gaaaaatactttaccgacaaataccccgaacgcgggctggcagttttgtcctgtatggat
gcgcggattatcgggctgctgcccgacgcgttgggtttgaaaaacggcgatgccaagctg
attaaaaatgccggcgcgctggttacgcacccgtggggttcggtgatgcggagccttttg
gttgccgtgtttgaactgaaggtcagagagattatggtcatcgcccatcacgattgcggt
atgcaggggctgaatgccgaagaattcctcgggcgcgtccgggaaagccggattcccgaa
gaccgtatcgaaaccctgcgttatgccggtatcgacctcgacggctggctgaccggtttc
gacaacgtcgaagacagcgtgcgccacacggtggaccttatccgtaaccatccgctgatg
ccgcgccatatcgccgttcacggactggtcatccatcccgttaccggcaaactgacgctg
gttgtggacggcagtgtttcagacggcatggacttatcggaaggaatggaaacatcatga

DBGET integrated database retrieval system