KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2026Help
Entry
NMB2026           CDS       T00027                                 

Definition
(RefSeq) ABC transporter permease
  KO
K02063  
thiamine transport system permease protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:nme00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    NMB2026
Transporters [BR:nme02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Thiamine transporter [MD:M00191] [OT]
    NMB2026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2142493..2144088)
Genome map
AA seq 531 aa AA seqDB search
MWGLLGTIATSVFQVGKAMDGRRWVVWGAFALLPSAFLAVMVVAPLWAVAAYDGLAWRAV
LSDAYMLKRLAWTVFQAAATCVLVLPLGVPVAWVLARLAFPGRALVLRLLMLPFVMPTLV
AGVGVLALFGADGLLWRGRQDTPYLLLYGNVFFNLPVLVRAAYQGFVQVPAARLQTARTL
GAGAWRRFWDIEMPVLRPWLAGGVCLVFLYCFSGFGLALLLGGSRYATVEVEIYQLVMFE
LDMAVASVLVWLVLGVTAAAGLLYAWFGRRAVSDKAVSPVMPSPPQSVGEYVLLAFAAAV
LSVCCLFPLLAIVVKAWSAGESWRVLMESETWQAVWNTLRFSAAAVYAAAVLGVVYAAAA
RRSAWMRGLMFLPFMVSPVCVSAGVLLLYPQWTASLPLLLAMYALLAYPFVAKDVLSAWD
ALPPDYGRAAAGLGANGFQTACRITFPLLKPALRRGLTLAAATCVGEFAATLFLSRPEWQ
TLTTLIYAYLGRAGEDNYARAMVLTLLLAAFALGIFLLLDGGEGGKQTETL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggcttttgggtacaatcgcaacatcagtgtttcaagtggggaaggcgatggat
ggacggcgttgggtggtatggggtgcttttgccctgctgccttcggcttttttggcggta
atggtcgttgcgcctttgtgggcggtggcggcgtatgacggtttggcgtggcgcgcggtg
ctgtcggatgcctatatgctcaaacgtttggcgtggacggtatttcaggcagcggcaacc
tgtgtgctggtgctgcctttgggcgtgcctgtcgcgtgggtgctggcgcggctggcgttt
ccggggcgggctttggtgctgcgcctgctgatgctgccttttgtgatgcccacgttggtg
gcgggcgtgggcgtgctggccctgttcggggcggacgggctgttgtggcgcggcaggcag
gatacgccgtatctgttgttgtacggcaatgtgtttttcaaccttcctgtgttggtcagg
gcggcgtatcaggggtttgtgcaagtgcctgcggcacggcttcagacggcacggacgttg
ggcgcgggggcgtggcggcggttttgggacattgaaatgcccgttttgcgcccgtggctt
gccggcggcgtgtgccttgtctttctgtattgtttttccgggttcgggctggcgctgctg
ctgggcggcagccgttatgccacggtcgaagtggaaatttaccagttggtcatgttcgaa
ctcgatatggcggttgcttcggtgctggtgtggctggtgttgggggtaacggcggcggca
gggttgctgtatgcgtggttcggcaggcgcgcggtttcggataaggcggtttcccctgtg
atgccgtcgccgccgcagtcggtcggggaatatgtgctgctggcgtttgcggcggcggtg
ttgtctgtgtgctgcctgtttcctttgttggcaattgttgtgaaagcgtggtcggccggc
gaatcgtggcgtgtgttaatggaaagtgaaacgtggcaggcggtgtggaatactttgcgc
ttctcggcggcggcggtgtatgcggcggcggttttgggtgtggtgtatgcggcggcggcg
cggcggtcggcgtggatgcgcgggctgatgtttttgccgtttatggtgtcgccggtttgt
gtttcggcgggcgtgctgctgctttatccgcagtggacggcttcgttgccgttgctgctg
gcgatgtatgcgctgctggcgtatccgtttgtggcaaaagatgttttatcagcctgggat
gcactgccgccggattacggcagggcggcggcgggtttgggtgcaaacggctttcagacg
gcatgccgcatcacgttccccctcttgaaaccggcgttgcggcgcggtctgactttggcg
gcggcaacctgcgtgggcgaatttgcggcgacattgtttctgtcgcgtccggaatggcag
acgctgacgactttgatttatgcctatttgggacgcgcgggtgaggataattacgcgcgg
gcgatggtgctgacattgctgttggcggcgttcgcgctgggtattttcctgctgttggac
ggcggcgaaggcggaaaacagacggaaacgttataa

DBGET integrated database retrieval system