KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2027Help
Entry
NMB2027           CDS       T00027                                 

Gene name
gntP
Definition
(RefSeq) gluconate permease
  KO
K03299  
gluconate:H+ symporter, GntP family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   NMB2027 (gntP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2144427..2145812
Genome map
AA seq 461 aa AA seqDB search
MDGWTQTLSAQTLLGISAAAIILILILIVKFRIHALLTLVIVSLLTALATGLPTGSIVND
ILVKNFGGTLGGVALLVGLGAMLGRLVETSGGAQSLADALIRMFGEKRAPFALGVASLIF
GFPIFFDAGLIVMLPIVFATARRMKQDVLPFALASIGAFSVMHVFLPPHPGPIAASEFYG
ANIGQVLILGLPTAFITWYFSGYMLGKVLGRTIHVPVPELLSGGTQDNDLPKEPAKAGTV
VAIMLIPMLLIFLNTGVSALISEKLVSADETWVQTAKIIGSTPIALLISVLVALFVLGRK
RGESGSALEKTVDGALAPVCSVILITGAGGMFGGVLRASGIGKALADSMADLGIPVLLGC
FLVALALRIAQGSATVALTTAAALMAPAVAAAGFTDWQLACIVLATAAGSVGCSHFNDSG
FWLVGRLLDMDVPTTLKTWTVNQTLIALIGFALSALLFAIV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggacggctggacacagacgctgtccgcgcaaaccctgttgggcatttcggcggcggca
atcatcctcattctgattttaatcgtcaaattccgcatccacgcgctgctgacactggtc
atcgtcagcctgctgacggctttggcaaccggtttgcccacaggcagcattgtcaacgac
atactggtcaaaaacttcggcggcacgctcggcggcgtggcgcttctggtcggcctgggc
gcgatgctcggacgtttggtcgaaacatccggcggcgcacagtcgctggcggacgcgctg
atccggatgttcggcgaaaaacgcgcaccgttcgcgctgggcgttgcctcgctgattttc
ggcttcccgattttcttcgatgccggactaatcgtcatgctgcccatcgtgttcgccacc
gcacggcgcatgaaacaggacgtactgcccttcgcgcttgcctccatcggcgcattttcc
gtcatgcacgtcttcctgccgccccatccgggcccgattgccgcttccgaattttacggc
gcgaacatcggccaagttttgattttgggtctgccgaccgccttcatcacatggtatttc
agcggctatatgctcggcaaagtgttggggcgcaccatccatgttcccgttcccgaactg
ctcagcggcggcacgcaagacaacgacctgccgaaagaacctgccaaagcaggaacggtc
gtcgccatcatgctgattcccatgctgctgattttcctgaataccggcgtatcggccctc
atcagcgaaaaactcgtaagtgcggacgaaacctgggttcagacggcaaaaataatcggt
tcgacaccgatcgcccttctgatttccgtattggtcgcactgtttgtcttgggacgcaaa
cgcggcgaaagcggcagcgcgttggaaaaaaccgtggacggcgcactcgcccccgtctgt
tccgtgattctgattaccggcgcgggcggtatgttcggcggcgttttgcgcgcttccggc
atcggcaaggcactcgccgacagcatggcggatttgggcattcccgtccttttgggctgt
ttccttgtcgccttggcactgcgtatcgcgcaaggttcggcaaccgtcgccctgaccacc
gccgccgcgctgatggctcctgccgttgccgccgccggctttaccgactggcagctcgcc
tgtatcgtattggcaacggcggcaggttcggtcggttgcagccacttcaacgactccggc
ttctggctggtcggccgtctcttggacatggacgtaccgaccacgctgaaaacctggacg
gtcaaccaaaccctcatcgcactcatcggctttgccttgtccgcactgctgttcgccatc
gtctga

DBGET integrated database retrieval system