KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2028Help
Entry
NMB2028           CDS       T00027                                 

Gene name
gntK
Definition
(RefSeq) thermoresistant gluconokinase
  KO
K00851  
gluconokinase [EC:2.7.1.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB2028 (gntK)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB2028 (gntK)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.12  gluconokinase
     NMB2028 (gntK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2145832..2146350
Genome map
AA seq 172 aa AA seqDB search
MTTHFVVMGVCGCGKTTAALSLQKHLGQCPYAEGDEFHTQANRDKMGAGIPLTDEDRYPW
LGNLRDWMTQQAQNGANHTIVTCSALKRGYRDILRGAEGKAAFIHLSPPQDINLERMMSR
KGHYMKAGMLDSQLEILEELGEGEYGVKIANPGTPEAVEADILNWVASENLL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgactacgcattttgtcgttatgggcgtatgcggctgcggcaagaccaccgccgcgctg
tccctgcagaaacacctcggtcaatgtccctatgccgaaggcgacgagttccacacccaa
gccaaccgcgacaagatgggcgcgggtattccgctgaccgatgaagaccgctatccgtgg
ttgggcaatctgcgcgactggatgacgcaacaggcgcaaaacggtgcgaaccacaccatc
gtaacctgttccgccctcaaacgcggctaccgcgacattctgcgcggagccgaaggcaaa
gctgccttcatccacctcagtccgccgcaagacatcaacctcgagcgcatgatgtcgcgc
aaaggacattacatgaaagcagggatgctcgattcgcaactggaaatcctcgaggaactg
ggcgaaggcgaatacggggtcaaaatcgccaaccccggcacgcccgaagcggtcgaagcc
gatattctgaactgggttgcctcggaaaacctgctttga

DBGET integrated database retrieval system