KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2029Help
Entry
NMB2029           CDS       T00027                                 

Gene name
thrB
Definition
(RefSeq) homoserine kinase
  KO
K02204  
homoserine kinase type II [EC:2.7.1.39]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB2029 (thrB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB2029 (thrB)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     NMB2029 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2146689..2147606)
Genome map
AA seq 305 aa AA seqDB search
MSVYTSVSDDEMRGFLSGYDLGEFVSLQGIAQGITNSNYFLTTTSGRYVLTVFEVLKQEE
LPFFLELNRHLSMKGVAVAAPVARKDGRLDSVLAGKPACLVACLKGSDTALPTAEQCFHT
GAMLAKMHLAAADFPLEMENPRYNAWWTEACARLLPVLSQDDAALLCSEIDALKDNLGNH
LPSGIIHADLFKDNVLLDGGQVSGFIDFYYACRGNFMYDLAIAVNDWARTADNKLDEALK
KAFIGGYEGVRPLSAEEKAYFPTAQRAGCIRFWVSRLLDFHFPQAGEMTFIKDPNAFRNL
LLSLG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtctataccagtgtttccgatgatgaaatgcgcggcttcctgagcggttacgat
ttgggggaatttgtttccctgcagggcatcgcgcaggggattaccaacagcaattatttt
ctgacgacgacttcgggacgttatgtgctgaccgtgtttgaagtgttgaaacaggaagag
ctgccgttttttctggagcttaaccggcatttgagtatgaagggcgtggcggttgccgcg
ccggttgcgcgcaaagacggccggcttgattccgttttggcgggtaagcctgcctgcctg
gttgcctgcctgaaaggttcggataccgcgctgccgacggctgagcagtgttttcatacc
ggtgcgatgttggcgaaaatgcaccttgccgccgccgatttccctttggaaatggaaaac
ccgcgttacaatgcgtggtggacggaggcgtgcgcccggctgctgcccgtcctgtcgcaa
gacgatgccgcactgctgtgttccgaaatcgatgcgttgaaggacaatctcggcaatcat
ctgccttcgggcatcatccatgccgatctgtttaaagacaatgtgttgcttgacggcggt
caggtatcgggcttcatcgatttctattacgcctgccggggcaattttatgtatgacttg
gcgattgcggtcaacgattgggcaaggacggcggacaataagttggatgaggcgttgaaa
aaggcgtttatcggcggttatgagggcgtgcgccccttgagtgccgaagaaaaggcgtat
ttcccgaccgcccaacgtgccggctgcatccgtttttgggtgtcgcgcctgttggatttt
cattttccgcaggcgggcgagatgacgtttatcaaagacccgaacgcgttccgcaacctg
ctgttgagtttgggttga

DBGET integrated database retrieval system