KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2030Help
Entry
NMB2030           CDS       T00027                                 

Gene name
ubiG
Definition
(RefSeq) 3-demethylubiquinone-9 3-methyltransferase
  KO
K00568  
2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    NMB2030 (ubiG)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     NMB2030 (ubiG)
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     NMB2030 (ubiG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2147643..2148371)
Genome map
AA seq 242 aa AA seqDB search
MGGKMSDKKYNVDEGEIAKFSRIADKWWDKSGEFKTLHDINPLRLDYIDGHADLCGKRVL
DVGCGGGILAESMARRGAAFVKGIDMAEQSLETARLHAALNNVADIEYECIRVEDLAEAE
PHSFDVVTCMEMMEHVPDPAAIVRACANLVKPDGMVFFSTINKNPKSYLHLIVAAEYLLK
FVPKGTHDWKKFIAPAELARMCRQAGLDVADTKGMTYHVLSQTYALCDSTDVNYMFACRP
AF
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgggagggaaaatgtccgacaaaaaatataatgtcgatgagggggaaatcgccaaattc
agccggattgccgacaaatggtgggacaagtcgggcgagttcaaaaccttgcacgacatc
aatccgctgcggctggattatatcgacggacacgcggatttgtgcggcaaacgggttttg
gacgtgggctgcggcggcggcatcttggcggaaagtatggcgcggcgcggcgcggcgttt
gtaaagggcatcgacatggcggagcagtcgttggaaaccgcccgcctgcacgcggctttg
aacaatgtcgccgatatcgaatacgaatgtatccgcgtggaagaccttgccgaggcggaa
ccgcactcgttcgatgtggtaacgtgcatggaaatgatggaacacgtccccgatcccgcc
gccatcgtgcgtgcttgtgccaatctggtcaaaccggacggcatggtgtttttttccacc
atcaataaaaacccgaaatcgtacctgcatctgattgtggcggcggaatatctgttgaag
tttgtccccaaaggcacgcacgactggaaaaaattcatcgcacctgccgagctggcgcga
atgtgccgtcaggcaggcttggatgtggcggatacgaagggtatgacttaccatgtgttg
tcgcaaacttatgccctgtgcgattcgaccgatgtgaattatatgtttgcctgccgtccg
gcgttctga

DBGET integrated database retrieval system