KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2031Help
Entry
NMB2031           CDS       T00027                                 

Gene name
mtr
Definition
(RefSeq) amino-acid transport protein
  KO
K03835  
tryptophan-specific transport protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   NMB2031 (mtr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2148523..2149764
Genome map
AA seq 413 aa AA seqDB search
MPNKTPSLFGGAMIIAGTVIGAGMLANPTATSGVWFTGSLAVLLYTWFSMLSSGLMILEV
NTHYPHGASFDTMVKDLLGRGWNIINGIAVAFVLYLLTYAYIFVGGDLTAKGLGSAAGGD
VSLTVGQLVFFGILAFCVWASARLVDRFTGVLIGGMVLTFIWAAGGLIADAKPSVLFDTQ
APAGTNYWIYAATALPVCLASFGFHGNVSSLLKYFKGDAPKVAKSIWTGTLIALVIYVLW
QTAIQGNLPRNEFAPVIAAEGQVSVLIETLSKFAQTGNMDKILSLFSYMAIATSFLGVTL
GLFDYIADIFKWNDSISGRTKTAALTFLPPLISCLLFPTGFVTAIGYVGLAATVWTGIIP
AMLLYRSRKKFGAGKTYKVYGGLWLMVWVFLFGIVNIAAQVLSQMELVPVFKG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacaaaaccccttcactgttcggcggcgcgatgattatcgccggcacggtcatc
ggcgcaggcatgctcgccaacccgaccgccacatccggcgtatggtttaccggctcgctg
gccgtgttgctgtacacctggttttctatgctttccagcggcctgatgattttggaagtc
aacacccattatccgcacggcgcaagtttcgacacgatggtcaaagacctgctcggacgc
ggctggaacatcatcaacggcatcgccgtcgccttcgttttatacctgcttacttacgct
tatatcttcgtcggcggcgacctgaccgccaaaggcttaggcagcgcggcaggcggcgac
gtttcactcaccgtcggacaactcgtcttcttcggcatcctcgccttttgcgtatgggca
tccgcacgcttggtcgaccgcttcaccggcgtccttatcggcggcatggtattgaccttt
atttgggcggccggcgggctgattgccgatgccaagccgtccgtcctcttcgatacccaa
gcccccgccggcacaaactactggatttacgccgccaccgccctgcccgtctgcctcgct
tccttcggcttccacggcaacgtctccagcctgctcaaatactttaaaggcgacgcgccc
aaagtggctaaatccatctggacgggcacactgattgcgctggtaatttacgtcctctgg
caaaccgccatccaaggcaacctgccgcgcaacgagttcgcccccgtcatcgccgccgaa
gggcaagtctccgtcctcatcgaaaccctgtccaaattcgcccaaaccggcaatatggac
aaaatattgtccctgttttcctatatggcgatcgccacctcgtttttaggcgtaacgctc
ggactcttcgactacatcgccgacatcttcaaatggaacgacagcatctccggccgcacc
aaaaccgccgcgctgaccttcctgccgcccctgatttcctgcctgctcttccccaccggc
ttcgttaccgccatcggctacgtcggcctggcggcaaccgtctggacaggcatcatcccc
gccatgctgctctaccgttcgcgcaaaaaattcggcgcaggcaaaacctataaagtttac
ggcggcttgtggctgatggtttgggtcttccttttcggcatcgtcaacatcgccgcacag
gtattgagccaaatggaactcgtccccgtatttaaaggataa

DBGET integrated database retrieval system