KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2033Help
Entry
NMB2033           CDS       T00027                                 

Definition
(RefSeq) D,D-heptose 1,7-bisphosphate phosphatase
  KO
K03273  
D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC:3.1.3.82 3.1.3.83]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB2033
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.82  D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     NMB2033
    3.1.3.83  D-glycero-alpha-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     NMB2033
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Unusual sugar
  NMB2033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2151215..2151778
Genome map
AA seq 187 aa AA seqDB search
MKLIILDRDGVINQDRDDFVKSVDEWIPVEGSMDAVAFLTQAGYTVAVATNQSGIGRKYF
TVQNLTEMHAKMHRLVRQAGGEINGIWFCPHTDADNCNCRKPKPGMIEDIIGRFNAQASE
TWLVGDSLRDLQAIDAVGGKPALVLTGKGKKTLSQHGHELPEHTQVFDTLLDFSQYIMQE
NTAPQAD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcatcattctcgaccgcgacggcgtcatcaatcaggaccgcgacgacttcgtc
aaatccgttgacgagtggatacctgtcgaaggcagcatggatgcggtggcatttctgacg
caggcaggctacaccgtcgccgttgccaccaaccaatccggcatcgggcgcaaatatttt
accgttcaaaaccttaccgaaatgcacgccaaaatgcaccgcctcgtccgtcaggcaggc
ggcgaaatcaacggcatctggttctgcccgcacaccgatgccgacaactgcaactgccgc
aagcccaaaccgggtatgattgaagacatcatcggacgcttcaacgcccaagcctcggaa
acctggctggtcggcgacagcctgcgcgatttgcaggcaatcgatgccgtcggcggcaaa
cccgcgctggttctgaccggaaaaggcaaaaaaacgctctcccaacacggacacgaattg
cccgaacacacacaggttttcgataccctgctcgatttctcacaatacatcatgcaggaa
aacaccgcaccgcaagccgactga

DBGET integrated database retrieval system