KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2034Help
Entry
NMB2034           CDS       T00027                                 

Definition
(RefSeq) 1-acyl-SN-glycerol-3-phosphate acyltransferase
  KO
K00655  
1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NMB2034
   00564 Glycerophospholipid metabolism
    NMB2034
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     NMB2034
Lipid biosynthesis proteins [BR:nme01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   NMB2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2151807..2152550
Genome map
AA seq 247 aa AA seqDB search
MLIIRNLIYWLILCSTLIFLFPFMLLASPFRDGAHKMARVWVGILNWSLKHIVGLKYRII
GAENIPDRPAVICAKHQSGWETLALQDIFPPQVYVAKRELFKIPFFGWGLKLVKTIGIDR
NNRREANEQLIKQGLVRKNEGYWITIFPEGTRLAPGKRGKYKLGGARMAKMFEMDIVPVA
LNSGEFWPKNSFLKYPGEITVVICPTIPHASGSEAELMEKCEHLIETQQPLISGAGPFAA
KMPSETA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcatccgcaacctgatttactggctgatactctgttccaccctgattttcctc
tttccctttatgctgctcgcctcgcctttccgggacggggcgcacaagatggcgcgggtc
tgggtcggcattctcaactggtcgctcaaacacatcgtcgggctcaaataccgcatcatc
ggcgcggaaaacatccccgaccgccccgccgtcatctgcgccaaacaccaaagcggctgg
gaaacgctcgcccttcaggacatttttccgccgcaggtttacgttgccaaacgcgagttg
ttcaaaatcccctttttcggctggggcttgaaactggtcaaaaccataggcatagaccgc
aacaaccgccgcgaagccaacgagcagctcataaaacaggggttggtgcgcaaaaacgaa
ggctattggattaccattttccccgaaggcacgcgccttgcgcccggaaaacgcggcaaa
tacaaactcggcggcgcgcgcatggcgaaaatgtttgagatggacatcgtccccgtcgcc
ctcaacagcggcgaattttggccgaaaaactcctttctgaaatatccgggggaaatcacc
gtcgtcatctgtccgaccatcccgcacgcaagcggcagcgaagccgaattgatggaaaaa
tgcgaacatctcatcgaaacgcaacaaccgcttatttccggcgcaggcccgtttgccgcc
aaaatgccgtctgaaaccgcatga

DBGET integrated database retrieval system