KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2040Help
Entry
NMB2040           CDS       T00027                                 

Gene name
thiC
Definition
(RefSeq) thiamine biosynthesis protein ThiC
  KO
K03147  
phosphomethylpyrimidine synthase [EC:4.1.99.17]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NMB2040 (thiC)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.17  phosphomethylpyrimidine synthase
     NMB2040 (thiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2159620..2161521)
Genome map
AA seq 633 aa AA seqDB search
MTTPKKTAKTSGNEARELADLSEDIGICFKYPNSERVYLQGSRDDIRVPLREIRQDDTYT
AQGTEANPPIPVYDTSGVYGDPAAHIDLKQGLPHIRTAWLDERGDTEILPKLSSEYGIER
AHDPKTAHLRFNQITRPRRAKSGSNVTQLHYARQGIITPEMEFVAIRERLKLDELSQKPE
YAKLLEQHAGQSFGANIPTHPDQITPEFVRQEIAAGRAIIPANINHPELEPMIIGRNFRV
KINGNLGNSAVTSSLTEEVEKMVWSLRWGADTIMDLSTGAHIHETREWIIRNAPVPIGTV
PIYQALEKTGGIAEDLTWDLFRDTLIEQAEQGVDYFTIHAGVLLRYVPMTANRLTGIVSR
GGSIMAKWCLAHHRENFLYTHFDEICEIMKAYDVSFSLGDGLRPGCIADANDESQFAELH
TLGELTDKAWKHDVQVMIEGPGHVPLQRVKENMTEELQHCFEAPFYTLGPLVTDIAPGYD
HITSGIGAANIGWYGTAMLCYVTPKEHLGLPDKEDVRTGIITYKLAAHAADLAKGWPGAQ
LRDNALSKARFEFRWRDQFRLSLDPERAESFHDETLPAEGAKIAHFCSMCGPKFCSMKIT
QEVRDYADKQKAQRQGMEEKAVEFVKKGAKIYS
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgactacgccaaaaaaaaccgccaaaacttccggcaacgaagcgcgcgagcttgccgac
ttgagcgaagacatcggcatctgctttaaatatccgaactcggaacgcgtgtatctgcaa
ggcagccgcgacgacatccgcgtgcctttgcgcgaaatccgtcaggacgacacctacacg
gcgcaaggtacggaagccaatccgccgattcccgtctacgacaccagcggcgtgtacggc
gacccggcggcgcatatcgacctgaaacaaggtctgccgcacatccgcaccgcgtggctg
gacgaacgcggcgataccgaaatcctgcccaagctctccagcgaatacggcatcgaacgc
gcacacgatccgaaaaccgcccatctgcgtttcaaccaaatcacccgcccgcgccgcgcg
aaaagcggcagcaacgtaacccagcttcactacgcgcgccaaggcattatcacgcccgaa
atggagtttgtcgccatacgcgaacgtttaaaattagacgaattgtcccaaaaaccggaa
tacgccaaactcttggaacagcacgcggggcaaagtttcggtgcgaacatcccgacccat
cccgaccaaatcacgcccgaattcgtgcgccaagaaatcgccgccggacgcgcgattatt
cccgccaacatcaaccaccccgaactcgaaccgatgattatcggccgcaactttcgtgtc
aaaatcaacggcaacttgggcaactccgccgtcacctccagcctgaccgaagaagtcgaa
aaaatggtgtggtcgctgcgttggggcgcggacacgattatggatttgtccaccggcgcg
cacatccatgaaacgcgcgaatggattatccgcaacgcgcccgtccccatcggcaccgtg
ccgatttaccaagcgttggaaaaaaccggcggcatcgccgaagatttgacttgggatttg
ttccgcgacaccctcatcgaacaggcggagcaaggcgtggactatttcaccatacacgcg
ggcgtgttgctgcgttatgtgccgatgaccgccaaccgcctcaccggcatcgtctcgcgc
ggcggttcgattatggcgaaatggtgtttggcacatcatcgggaaaatttcctctacacg
catttcgacgaaatctgcgaaattatgaaagcgtatgacgtatcgttcagcctcggcgac
ggcctgcgccccggctgcattgccgatgccaacgacgaatcccaattcgccgaactgcac
accttgggcgaattgaccgataaagcgtggaaacatgacgtacaagtcatgatcgaaggc
cccggccatgtgccgctgcaacgcgtcaaagaaaacatgaccgaagagctgcaacactgc
tttgaagcacctttttacacgctcggcccgctcgttaccgacatcgcacccggctacgac
cacatcacctcgggcataggcgcggccaatatcggctggtacggcacggcgatgctttgt
tacgttaccccgaaagagcatttggggctgcccgacaaagaagacgtgcgcaccggcatc
atcacctacaaactcgccgcccacgccgccgatctcgccaaaggctggccgggcgcacaa
ttacgtgacaacgccctgagcaaagcgcgtttcgagttccgctggcgcgaccaatttcgc
ttaagcctcgaccctgaacgtgccgagagcttccacgacgaaaccctgcctgccgaaggc
gcgaaaatcgcccacttctgctcgatgtgcggccccaaattctgctcgatgaaaatcacg
caggaagtgcgcgactacgccgacaagcaaaaagcccaacggcagggcatggaggaaaaa
gcggtcgagttcgtcaaaaaaggcgcgaagatttacagttaa

DBGET integrated database retrieval system