KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2045Help
Entry
NMB2045           CDS       T00027                                 

Gene name
ptsH
Definition
(RefSeq) sugar transport PTS system phosphocarrier protein HPr
  KO
K11189  
phosphocarrier protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8 4.A.2]
    NMB2045 (ptsH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2168320..2168589)
Genome map
AA seq 89 aa AA seqDB search
MLKQSIEIINKLGLHARASNKFTQTASQFKSEVWVTKNDSRVNGKSIMGLMMLAAAKGTV
IELETDGADEAEAMRALTDLINGYFGEGE
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacaatccatcgaaatcatcaacaaactcggactccacgcccgcgcgtccaac
aagttcacccaaaccgcgtcccaattcaaaagcgaagtctgggttacgaaaaacgacagc
cgcgtcaacggcaaaagcattatggggctgatgatgctcgccgccgccaagggtacggtc
atcgaactggagacggacggcgcggacgaggcggaagcgatgcgcgccctgaccgactta
atcaacggctacttcggcgagggcgaataa

DBGET integrated database retrieval system