KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2046Help
Entry
NMB2046           CDS       T00027                                 

Definition
(RefSeq) PTS system transporter subunit IIAB
  KO
K02821  
PTS system, ascorbate-specific IIA component [EC:2.7.1.194]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    NMB2046
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    NMB2046
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.194  protein-Npi-phosphohistidine---L-ascorbate phosphotransferase
     NMB2046
Transporters [BR:nme02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component [MD:M00283]
    NMB2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2168658..2169116)
Genome map
AA seq 152 aa AA seqDB search
MRNRTHNMIGLLIITHETIGEAYRKLAHHFFPGGLPENVRILGVQPTEDQDDINNNAIAA
LQEFPDNDGVLIMTDIFGATPCNAARRLVRENKSAILTGLNAPMMVKAVQYSPAAEDLAA
FTECVREAAVKGIFAITSAPEDLVCRRSGDAV
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacaggacgcataatatgatagggcttttaatcatcacacacgaaaccataggc
gaagcctaccgcaagctggcgcatcatttttttccgggcggactgcctgaaaacgtccgc
atactcggcgtgcagccgacggaagaccaagacgacatcaacaacaacgccattgccgcg
cttcaggaatttcccgacaacgacggcgtgctgattatgaccgatattttcggtgcgacc
ccctgcaatgccgcccgccgcctcgtgcgcgaaaacaaatcggcgattttgaccgggctg
aacgcgccgatgatggttaaggccgtccaatattcgccggcggcggaagaccttgccgcc
tttaccgaatgcgtcagggaggcggcggtaaaaggcattttcgccatcacgtccgcgccc
gaagatttggtgtgccggcgcagcggcgatgccgtctga

DBGET integrated database retrieval system