KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2047Help
Entry
NMB2047           CDS       T00027                                 

Definition
(RefSeq) hypoxanthine-guanine phosphoribosyltransferase
  KO
K00760  
hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB2047
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     NMB2047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2169176..2169739)
Genome map
AA seq 187 aa AA seqDB search
MTDLETKRLETQAMLENADLLFDQGQCRAALQKVADEITRDLGGKYPLLLPVMGGAVVFT
GQLLPLLRFPLDFDYVHVSRYGDKLEGGAFNWKRMPDAEQIRGRHVVVLDDILDEGHTMS
AIQAKLLEMGAASCRAAVFANKLIDKPKPIRADYVGLDVPNRYVFGYGMDAAGCWRNLGE
IYALGGK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttagaaaccaaacgccttgaaacacaggcgatgcttgaaaacgccgatctt
ttgttcgaccaaggccaatgccgtgccgcactgcaaaaagtggcggacgagattacgcgt
gatttgggcggcaaatatccgctgctgctgcccgtgatgggcggcgcggtggtgtttacg
gggcagttgctgccgctgttgcgttttcccttagattttgattatgttcacgtttcccgt
tacggcgacaagctggagggcggcgcgttcaactggaagcgtatgcccgatgcggaacaa
atccggggcaggcacgtcgtcgtgctggacgatattttggacgaagggcatacgatgtcc
gccattcaagccaaacttttggaaatgggtgcggcaagctgccgtgcggcggtgttcgcc
aacaagctgattgacaaacccaagcctatccgagccgattatgtcggactggatgtgccg
aaccgttatgttttcggttacggcatggatgcggcgggctgctggcgcaatctgggcgag
atttacgcattgggcggaaaataa

DBGET integrated database retrieval system