KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2051Help
Entry
NMB2051           CDS       T00027                                 

Gene name
petC
Definition
(RefSeq) cytochrome C1
  KO
K00413  
ubiquinol-cytochrome c reductase cytochrome c1 subunit
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    NMB2051 (petC)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NMB2051 (petC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2173686..2174486)
Genome map
AA seq 266 aa AA seqDB search
MRAAKMKQTLKNWFAALLLAVPMSAAVASGGGHYEKVDIDLRDQVSLQHGAQIFTNYCLS
CHSASGMRFNRLKDIGLTDEEIKKNLMFTTDNVGDVMHSAMNPKDAAKWFGAAPPDLTLI
ARSKGADYLYAYMRGFYKDPTRPSGWNNTVFDKVGMPHPLWEQQGVQAVELDAKGQPVMV
KDEHGEMKPKLYWESTGLHSRRLPNGKVIQKEYDAYVRDLVNYLVYMGEPAQLQRKRIGY
VVMIFLFAVMLPLAYFLNKEYWKDVH
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagggcagcgaaaatgaaacaaactctgaaaaactggtttgctgccttattgctggca
gtgcctatgagtgcagccgtcgccagcggcggcggacactacgaaaaagtcgatatcgac
ctgcgtgaccaagtcagcctgcagcacggtgcgcaaatctttacaaactactgtttgtct
tgccactctgcaagcggtatgcgcttcaaccgtctgaaagacatcggtttgactgacgaa
gaaatcaagaaaaacctgatgtttaccaccgataatgtcggcgatgtcatgcattcggcg
atgaacccgaaagatgcggcaaaatggtttggtgctgctccgcccgatttgacgttgatt
gcgcgttccaaaggtgcagactacctttacgcctatatgcgcggcttctataaagatccg
acccgtccgagcggctggaacaatactgtattcgataaagtcggtatgccccacccgttg
tgggagcaacaaggtgttcaagccgttgagttggatgccaaaggtcagccggttatggta
aaagacgaacacggcgagatgaagcctaagctgtattgggaatctaccggtttgcacagc
cgccgcctgcctaacggcaaagtgatccaaaaagagtacgacgcatatgtacgcgatttg
gtcaattaccttgtgtacatgggcgaacctgcacaactgcaacgcaaacgtataggctat
gtcgtgatgattttcctatttgcggttatgctgcctttggcttacttcctaaataaagaa
tattggaaagacgtacactaa

DBGET integrated database retrieval system