KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2060Help
Entry
NMB2060           CDS       T00027                                 

Gene name
gpsA
Definition
(RefSeq) NAD(P)H-dependent glycerol-3-phosphate dehydrogenase
  KO
K00057  
glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NMB2060 (gpsA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     NMB2060 (gpsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2180518..2181507)
Genome map
AA seq 329 aa AA seqDB search
MKITVIGAGSWGTALALHFSQHGNRVSLWTRNADQVRQMQEARENKRGLPGFSFPETLEV
CADLADALKDSGLVLIVTSVAGLRSSAELLKQYGAGHLPVLAACKGFEQDTGLLTFQVLK
EVLPDNKKIGVLSGPSFAQELAKQLPCAVVLASENQEWIEELVPQLNTTVMRLYGSTDVI
GVAVGGAVKNVMAIATGLSDGLEYGLNARAALVTRGLAEITRLASAMGAQPKTMMGLAGI
GDLILTCTGALSRNRRVGLGLAEGKELHQVLVEIGHVSEGVSTIEEVFNTACKYQIDMPI
TQTLLQLIRKEMTPQQVVERLMERSARFE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaccgttatcggcgcaggttcgtggggtacggcgctcgccctgcatttttcc
caacacggcaaccgcgtatccctgtggacgcgcaacgcagaccaagtccgtcaaatgcag
gaagcgcgtgaaaacaaacgcggactgcccggcttttcctttcccgaaaccttggaagtg
tgtgcggatttggcagacgcgctcaaagacagcggacttgtccttatcgtaacctccgtt
gccggattgagaagcagcgcagagctgctcaaacagtacggcgcgggacacctccccgtc
ctcgccgcctgcaaaggattcgagcaggataccgggctgctgacctttcaagtcttgaaa
gaagtattgcccgacaataagaaaatcggcgtactttccggcccgagttttgcacaggaa
ctcgccaaacaactgccctgcgccgtcgtccttgcctccgaaaaccaagagtggattgaa
gaactcgtaccgcagctcaacacgaccgtcatgaggctttacggcagtaccgatgttatc
ggcgtggcggttggcggcgcggtaaaaaatgttatggcgattgccaccggattgtccgac
ggcctagagtacgggcttaacgcccgtgccgcactggttacgcgcggattagctgaaatc
acccgccttgcctccgcaatgggcgcacagcccaaaaccatgatggggctggcaggcatc
ggcgacctcatcctcacctgcaccggcgcactttcgcgcaaccgccgcgtcggcttgggt
ttggcagaaggcaaggaactgcatcaggtgctggtcgaaatcggacacgtttccgaaggg
gtcagcacgatagaagaagtcttcaatactgcctgtaagtaccaaatcgacatgccgatt
acccaaactctgctgcaactcatccgcaaagaaatgaccccgcaacaggttgtcgaaaga
ctgatggaacgcagcgcgcgttttgaataa

DBGET integrated database retrieval system