KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2061Help
Entry
NMB2061           CDS       T00027                                 

Gene name
ppc
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB2061 (ppc)
  Energy metabolism
   00680 Methane metabolism
    NMB2061 (ppc)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NMB2061 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2181630..2184332)
Genome map
AA seq 900 aa AA seqDB search
MQLHILNNPKDAALAADAEFLKQSLFNLLHEEASPLVVETVKLLSTSDDSAALIEKVLPQ
LDEQQTHDLTLACGLFAQILNIAEDVHHERRRQIHEEAGRGGAEGSLTETVRRLKAGKAD
GKSVQRQLDNTSVTAVLTAHPTEVQRQTVLSFNRRIRALLPQRERCTNADALARLRREID
TILLGLWQTSETRRHKLSVNDEINNGVSIFPMSFFEALPKLYRKMEHDFQTAYPGVRVPD
ILKIGGWIGGDRDGNPFVSAETLRFAFRRHADAVFRFYRGELDKLYRELPLSIRRVKVNG
DVTALSDKSPDEEIARAEEPYRRAIAYIMARAMGKARALGLGMGCKFGFLEPYASAQEFL
DDLKKLQRSLIDNGSRLLAEGRLADLIRSVSVFGFHMMPLDLRQHAGKHADVVAELFQHA
GLEDYNRLNEEQKQTALLRELSHQRPLYSPFITYSDHTRHELAIFNEARKIKDEFGEDAV
TQSIISNCEQPSDLLALALLLKETGLLAVENGKPHSRINIVPLFETIEALENACPVMETM
FRLDWYDALLESRGNIQEIMLGYSDSNKDGGYVTSSWCLYQAELGLVELFKKYDVRMRLF
HGRGGSVGRGGGPSYQAILAQPAGSVAGQIRITEQGEVITAKYADPGNAQRNLETLVAAT
LEASILPDKKDPDAKLMQALSDVSFKYYRELITHPDFIDYFLQTSPIQEIATLNLGSRPA
SRKTLARIQDLRAIPWVFSWMQNRLMLPAWYGFGSAVETLCEDKPETLAALREHAQSNPF
FQAMLSNMEQVMAKTDITLAENYAGLSESPDKAKIIFGMIKEEYRRSRKALLDLLQTEEL
LRDNRSLARSLALRIPYLNALNGLQVAMLKRLRKEPDNPHALLMVHLTINGVAQGLRNTG
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgcatattctgaacaatccaaaggacgcggctttggcggcggacgcggaattt
ctgaaacaatccctgttcaacctcctgcacgaagaagcctcgccgttggttgtcgaaaca
gtcaaactcttgtccacttccgacgacagcgcggcattgattgaaaaagtattgccgcaa
ttggacgaacaacaaacccacgatttaaccttggcctgcggcctgttcgcccagattttg
aacatcgccgaagacgtgcaccacgaacgccgccgccaaatccacgaagaagccggacgc
ggcggcgcggaaggcagcctgacggaaaccgtccgcaggctcaaagcggggaaagccgac
ggcaaatcggtgcagcggcagttggacaatacgtccgttaccgccgttttgaccgcgcac
ccgaccgaagtgcaacgccaaaccgtcttaagcttcaaccgccgcatccgcgcactgttg
ccgcaacgcgaacgctgcaccaatgccgacgcgctggcacggctgcgccgcgaaatcgac
actatcctgctgggcttgtggcagaccagcgaaacgcgccgccacaaactcagcgtcaac
gacgaaatcaacaacggcgtgtccatcttcccgatgagctttttcgaagccctgcccaag
ctctaccgcaagatggaacacgactttcagacggcctatcccggcgtccgcgttccggac
atcctcaaaatcggcggctggatcggcggcgaccgcgacggcaatccgtttgtttctgcc
gaaaccctgcgctttgccttccgccgccacgccgatgccgtgttccgcttctatcgcggc
gaactcgacaaactctaccgcgaactgccgctctccatccgccgcgtcaaagtcaacggc
gatgtaacggcgttgtccgacaaatcgcccgacgaagaaatcgcccgcgccgaagaaccc
taccgccgcgccatcgcctacattatggcgcgcgctatgggcaaagcgcgcgcgctcggt
ttgggtatgggctgcaaattcggctttctcgagccttatgcttcggcacaagagtttctg
gatgatttgaaaaaattgcaacgttcccttatcgacaacggcagccgtctgcttgccgaa
ggccgtttggcagacctcatccgttccgtatccgtgttcggctttcacatgatgccgctc
gacttgcgccaacacgcaggcaaacacgccgatgtggttgccgagcttttccaacacgca
ggcttggaagactacaaccgcctgaacgaagagcaaaaacaaaccgccctgttgcgcgaa
ttgagccatcaacgtcctctgtacagcccgtttatcacatacagcgaccatacccgccac
gaactggcaattttcaacgaagcgcgcaaaatcaaagacgaatttggcgaagatgccgta
acacaaagcattatttccaactgcgaacaacccagcgacctgctcgccttggcattgctg
ctgaaagaaaccggcctgttggcggtggaaaacggcaaaccgcacagccgcatcaatatc
gtgccgctgtttgaaaccattgaagcgttggaaaacgcctgtccggtcatggaaaccatg
ttccgcctcgactggtacgatgcactgctcgaaagccgtggaaacatccaagaaatcatg
ctcggctattccgactccaacaaggacggcggctacgttaccagctcatggtgcctctat
caggcggaattgggcttggtcgaactcttcaaaaaatacgatgtccgtatgcgcctgttc
cacggacgcggcggcagcgtaggtcgcggcggcggcccttcttaccaagccattctcgcc
caaccggcgggcagcgtggcgggacaaatccgcatcaccgaacaaggcgaagtcattacc
gccaaatacgccgaccccggcaatgcccaacgcaacttggaaaccttggttgccgcgact
ttggaagccagcatcctgccggataaaaaagaccctgatgccaaactgatgcaggcattg
tcggacgtatcgttcaaatactaccgcgaactgattacccatcccgacttcatcgactac
tttctgcaaaccagcccgattcaggaaatcgccaccctcaacctaggcagccgtcccgcc
agccgcaaaaccttggcgcggattcaggacttgcgcgcgattccgtgggtattttcctgg
atgcagaaccgcctcatgctgccggcttggtacggtttcggcagcgcggtggaaaccttg
tgcgaagacaaacccgaaacgctcgccgccctgcgcgaacacgcccaaagcaacccgttc
ttccaagccatgctctccaatatggaacaagtgatggcgaaaaccgacatcaccctcgcg
gaaaactatgccggcttgagcgaatcgcccgataaggcaaaaatcatcttcgggatgatt
aaggaagaataccgccgcagccgcaaagcactgctcgacctactgcaaaccgaagagctt
ttgcgcgacaaccgcagcctcgcccgttcgctcgctttgaggattccctacctgaacgcg
ctcaacggtttgcaagtcgccatgctcaaacgcctgcgtaaagaacccgacaatccgcac
gcccttctgatggtgcacctgaccatcaacggcgtggcgcaaggtttgcgcaatacaggc
tga

DBGET integrated database retrieval system