KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2062Help
Entry
NMB2062           CDS       T00027                                 

Gene name
thiF
Definition
(RefSeq) molybdopterin/thiamine biosynthesis family protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2184502..2185272
Genome map
AA seq 256 aa AA seqDB search
MTTTEHDNDDAFLLRYSRHILLDEIGIEGQQKLSAAHILVVGCGGLGAAALPYLAASGVG
TLTIADSDTVELHNLQRQVAFDEGDVGKLKTEALAGRLKRINHTVNVRAVNEKLDGCRLT
GLVQAADIVLDCCDNYATRQAVNRACVQTKTPLVSGAAVRFEGQLAVYRPDLPDSPCYAC
LFDGGSASDGICSLFGVFSPLVGIIGSTQAAEALKILLDAGEPSHGRLAVYRALEGGWQY
FDLPRNPECPVCGTAR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaccgaacacgacaacgacgatgcattcctgctgcggtacagccgccacatc
ctcttggacgaaatcggcatcgaagggcagcagaaactttccgccgcgcatattttggtc
gtcggctgcggcggtttgggtgccgccgcactgccctaccttgccgcttcgggtgtcggc
acgctgaccatagccgattccgacacggtcgaactgcacaacctgcaacgccaagtcgca
tttgacgagggcgatgtcggcaaactcaaaaccgaagccttggcaggccgcctgaaacgc
atcaaccataccgtcaacgtccgcgccgtcaacgaaaaactcgacggctgccgcctgacc
ggtttggttcaagccgccgacatcgttttagactgttgcgacaactacgccacgcggcaa
gccgtcaaccgtgcctgcgtgcaaacgaaaacaccgctggtttcaggggcggcggtacgc
tttgaagggcaacttgccgtgtaccgtcccgacttgcccgactcgccgtgttacgcctgc
ctgtttgacggcggatcggcttcagacggcatctgttctctcttcggcgtgttctcgccg
ctggtcggcatcatcggcagtacccaagcggcggaggctctgaaaatcctgctggatgcg
ggcgaaccgtcgcacggcaggctggcggtttaccgtgccttggaagggggctggcaatat
ttcgacctgccgcgcaaccctgaatgcccggtttgcggcacagcgcgataa

DBGET integrated database retrieval system