KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2067Help
Entry
NMB2067           CDS       T00027                                 

Gene name
cytX
Definition
(RefSeq) hydroxymethylpyrimidine transporter CytX
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2190703..2191926
Genome map
AA seq 407 aa AA seqDB search
MSGNASSPSSSSAIGLIWFGAAVSIAEISTGTLLAPLGWQRGLAALLLGHAVGGALFFAA
AYIGALTGRSSMESVRLSFGKRGSVLFSVANMLQLAGWTAVMIYAGATVSSALGKVLWDG
ESFVWWALANGALIVLWLVFGARKTGGLKTVSMLLMLLAVLWLSAEVFSTAGSTAAQVSD
GMSFGTAVELSAVMPLSWLPLAADYTRHARRPFAATLTATLAYTLTGCWMYALGLAAALF
TGETDVAKILLGAGLGAAGILAVVLSTVTTTFLDAYSAGASANNISARFAETPVAVGVTL
IGTVLAVMLPVTEYENFLLLIGSVFAPMAAVLIADFFVLKRREEIEGFDFAGLVLWLAGF
ILYRFLLSSGWESSIGLTAPVMSAVAIATVSVRLFFKKTQSLQRNPS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaatgcctcctctccttcatcttcctccgccatcgggctgatttggttcggc
gcggcggtatcgattgccgaaatcagcacgggtacgctgcttgcgcctttgggctggcag
cgcggtctggcggctctacttttgggtcatgccgtcggcggcgcgctgttttttgcggcg
gcgtatatcggcgcactgaccggacgcagctcgatggaaagcgtgcgcctgtcgttcggc
aaacgcggttcagtgctgttttccgtggcgaatatgctgcaactggccggctggacggcg
gtgatgatttacgccggcgcaacggtcagctccgctttgggcaaagtgttgtgggacggc
gaatcttttgtctggtgggcattggcaaacggcgcgctgattgtgctgtggctggttttc
ggcgcacgcaaaacaggcgggctgaaaaccgtttcgatgctgctgatgctgttggcggtt
ctgtggctgagtgccgaagtcttttccacggcaggcagcaccgccgcacaggtttcagac
ggcatgagtttcggaacggcagtcgagctgtccgccgtgatgccgctttcctggctgccg
cttgccgccgactacacgcgccacgcgcgccgcccgtttgcggcaaccctgacggcaacg
ctcgcctacacgctgaccggctgctggatgtatgccttgggtttggcagcggcgttgttc
accggagaaaccgacgtggcaaaaatcctgctgggcgcaggtttgggtgcggcaggcatt
ttggcggtcgtcctctccaccgttaccacaacgtttctcgatgcctattccgccggcgcg
agtgcgaacaacatttccgcgcgttttgcggaaacacccgtcgctgtcggcgttaccctg
atcggcacggtacttgccgtcatgctgcccgttaccgaatatgaaaacttcctgctgctt
atcggctcggtatttgcgccgatggcggcggttttgattgccgactttttcgtcttgaaa
cggcgtgaggagattgaaggctttgactttgccggactggttctgtggcttgcgggcttc
atcctctaccgcttcctgctctcgtccggctgggaaagcagcatcggtctgaccgccccc
gtaatgtctgccgttgccattgccaccgtatcggtacgccttttctttaaaaaaacccaa
tctttacaaaggaacccgtcatga

DBGET integrated database retrieval system