KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2069Help
Entry
NMB2069           CDS       T00027                                 

Gene name
thiE
Definition
(RefSeq) thiamin-phosphate pyrophosphorylase
  KO
K00788  
thiamine-phosphate pyrophosphorylase [EC:2.5.1.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NMB2069 (thiE)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.3  thiamine phosphate synthase
     NMB2069 (thiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2193045..2193662
Genome map
AA seq 205 aa AA seqDB search
MTFPPLKSPLKFYAVVPTADWVGRMVKAGADTVQLRCKALHGDELKREIARCAAACQGSR
TQLFINDHWREAIEAGAYGVHLGQEDMDTADLAAIAAAGLRLGLSTHSVAELDRALSVHP
SYIASGAIFPTTTKQMPTAPQGLDKLREYVKQAGGTPVVAIGGIDLNNARAVLATGVSSL
AAVRAVTEAANPEAVVKAFQALWDG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcccgcccctaaaatccccgctcaaattctacgccgtcgtccccaccgccgat
tgggtggggcgcatggtcaaagcaggtgccgacacggtgcaactgcgctgcaaggccctg
cacggcgatgaattgaaacgcgaaatcgcccgctgcgccgcagcctgtcagggcagccgt
acgcagcttttcatcaacgaccactggcgcgaagcaatcgaagcgggcgcgtacggcgtg
catctcggacaagaagacatggacaccgccgaccttgccgccatcgccgccgccggtttg
cgcttgggtttgagtacgcactccgttgccgaactcgaccgcgccctgtccgtacaccct
agctacatcgccagcggcgcgattttcccgaccacgaccaaacaaatgcccaccgccccg
caaggcttggacaaactgcgcgaatacgtcaaacaagcaggcggcacgcccgtcgtcgcc
atcggcggtatcgacttgaacaacgcccgagccgtactcgccaccggcgtttcctcactc
gccgccgtccgcgccgtaaccgaagcggcaaatcccgaagcggtggttaaagcgtttcag
gctttgtgggatggataa

DBGET integrated database retrieval system