KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2075Help
Entry
NMB2075           CDS       T00027                                 

Definition
(RefSeq) bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pantothenate kinase
  KO
K01947  
biotin-[acetyl-CoA-carboxylase] ligase / type III pantothenate kinase [EC:6.3.4.15 2.7.1.33]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pantothenate and CoA biosynthesis
Biotin metabolism
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB2075
   00780 Biotin metabolism
    NMB2075
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     NMB2075
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.15  biotin---[acetyl-CoA-carboxylase] ligase
     NMB2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2196921..2198699)
Genome map
AA seq 592 aa AA seqDB search
MTVLKLSHWRVLAELADGLPQHVSQLARMADMKPQQLNGFWQQMPAHIRGLLRQHDGYWR
LVRPLAVFDAEGLRELGERSGFQTALKHECASSNDEILELARIAPDKAHKTICVTHLQSK
GRGRQGRKWSHRLGECLMFSFGWVFDRPQYELGSLSPVAAVACRRALSRLGLDVQIKWPN
DLVVGRDKLGGILIETVRTGGKTVAVVGIGINFVLPKEVENAASVQSLFQTASRRGNADA
AVLLETLLVELDAVLLQYARDGFAPFVAEYQAANRDHGKAVLLLRDGETVFEGTVKGVDG
QGVLHLETAEGKQTVVSGEISLRSDDRPVSVPKRRDSERFLLLDGGNSRLKWAWVENGTF
ATVGSAPYRDLSPLGAEWAEKADGNVRIVGCAVCGEFKKAQVQEQLARKIEWLPSSAQAL
GIRNHYRHPEEHGSDRWFNALGSRRFSRNACVVVSCGTAVTVDALTDDGHYLGGTIMPGF
HLMKESLAVRTANLNRHAGKRYPFPTTTGNAVASGMMDAVCGSVMMMHGRLKEKTGAGKP
VDVIITGGGAAKVAEALPPAFLAENTVRVADNLVIYGLLNMIAAEGREYEHI
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgacggttttgaagctttcgcactggcgggtgttggcggagcttgccgacggtttgccg
caacacgtctcgcaactggcgcgtatggcggatatgaagccgcagcagctcaacggtttt
tggcagcagatgccggcgcacatacgcgggctgttgcgccaacacgacggctattggcgg
ctggtgcgcccattggcggttttcgatgccgaaggtttgcgcgagctgggggaaaggtcg
ggttttcagacggcattgaagcacgagtgcgcgtccagcaacgacgagatactggaattg
gcgcggattgcgccggacaaggcgcacaaaaccatatgcgtgacccacctgcaaagtaag
ggcagggggcggcaggggcggaagtggtcgcaccgtttgggcgagtgtctgatgttcagt
tttggctgggtgtttgaccggccgcagtatgagttgggttcgctgtcgcctgttgcggca
gtggcgtgtcggcgcgccttgtcgcgtttaggtttggatgtgcagattaagtggcccaat
gatttggttgtcggacgcgacaaattgggcggcattctgattgaaacggtcaggacgggc
ggcaaaacggttgccgtggtcggtatcggcatcaattttgtcctgcccaaggaagtagaa
aatgccgcttccgtgcaatcgctgtttcagacggcatcgcggcggggcaatgccgatgcc
gccgtgctgctggaaacgctgttggtggaactggacgcggtgttgttgcaatatgcgcgg
gacggatttgcgccttttgtggcggaatatcaggctgccaaccgcgaccacggcaaggcg
gtattgctgttgcgcgacggcgaaaccgtgttcgaaggcacggttaaaggcgtggacgga
caaggcgttttgcacttggaaacggcagagggcaaacagacggtcgtcagcggcgaaatc
agcctgcggtccgacgacaggccggtttccgtgccgaagcggcgggattcggaacgtttt
ctgctgttggacggcggcaacagccggctcaagtgggcgtgggtggaaaacggcacgttc
gcaaccgtcggtagcgcgccgtaccgcgatttgtcgcctttgggcgcggagtgggcggaa
aaggcggatggaaatgtccgcatcgtcggttgcgctgtgtgcggagaattcaaaaaggca
caagtgcaggaacagctcgcccgaaaaatcgagtggctgccgtcttccgcacaggctttg
ggcatacgcaaccactaccgccaccccgaagaacacggttccgaccgctggttcaacgcc
ttgggcagccgccgcttcagccgcaacgcctgcgtcgtcgtcagttgcggcacggcggta
acggttgacgcgctcaccgatgacggacattatctcgggggaaccatcatgcccggtttc
cacctgatgaaagaatcgctcgccgtccgaaccgccaacctcaaccggcacgccggtaag
cgttatcctttcccgaccacaacgggcaatgccgtcgccagcggcatgatggatgcggtt
tgcggctcggttatgatgatgcacgggcgtttgaaagaaaaaaccggggcgggcaagcct
gtcgatgtcatcattaccggcggcggcgcggcaaaagttgccgaagccctgccgcctgca
tttttggcggaaaataccgtgcgcgtggcggacaacctcgtcatttacgggttgttgaac
atgattgccgccgaaggcagggaatatgaacatatttaa

DBGET integrated database retrieval system