KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2076Help
Entry
NMB2076           CDS       T00027                                 

Gene name
aut
Definition
(RefSeq) D-beta-D-heptose 1-phosphate adenylyltransferase
  KO
K21345  
D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase [EC:2.7.7.70]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB2076 (aut)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.70  D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase
     NMB2076 (aut)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2198696..2199202)
Genome map
AA seq 168 aa AA seqDB search
MVDAWSVPDFESKICPPEALAARLALLPRPLVFTNGCFDILHRGHVTYLAQARSMGDALV
LALNTDASVRRLGKGGDRPVNPLENRAAVAAALESVDLVTWFDGDTPAALIEAVKPEILV
KGGDWAADKIVGAAETLARGGQVFSIPFLHQTSTTKTLAKIRAAEGGK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggttgacgcttggtctgtccctgattttgaatcgaaaatctgtccgcccgaggcgttg
gcggcgcgtttggcgttgttgccgcgcccgctggtgtttaccaacggctgtttcgacatc
ctccacagggggcacgttacttatctggcgcaggcgcgttcgatgggggacgcgttggtg
ctggcgttgaataccgatgcttcggtgcggcgtctgggcaagggcggtgaccgcccggtt
aatcctttggagaaccgtgccgccgttgccgccgctttggaaagtgtggatttggtaacg
tggtttgacggggatacgccggcggcgttgattgaggcggtcaaacctgagattttggtc
aagggcggcgattgggctgcggataagattgtcggtgcggcagaaacgttggcgcgcggc
ggtcaggtgttttcaattccgtttctgcaccagacttcgacaacgaagactttggcaaaa
atccgtgcggcagagggcggaaaatga

DBGET integrated database retrieval system