KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2079Help
Entry
NMB2079           CDS       T00027                                 

Gene name
asd
Definition
(RefSeq) aspartate-semialdehyde dehydrogenase
  KO
K00133  
aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NMB2079 (asd)
   01230 Biosynthesis of amino acids
    NMB2079 (asd)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB2079 (asd)
   00270 Cysteine and methionine metabolism
    NMB2079 (asd)
   00300 Lysine biosynthesis
    NMB2079 (asd)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    NMB2079 (asd)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     NMB2079 (asd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2201514..2202629
Genome map
AA seq 371 aa AA seqDB search
MKVGFVGWRGMVGSVLMQRMKEENDFAHIPEAFFFTTSNVGGAAPDFGQAAKTLLDANNV
AELAKMDIIVTCQGGDYTKSVFQALRDSGWNGYWIDAASSLRMKDDAIIVLDPVNRDVLD
NGLKNGVKNYIGGNCTVSLMLMALGGLFQNDLVEWATSMTYQAASGAGAKNMRELISGMG
AVHAQVADALADPAGSILDIDRKVSDFLRSEDYPKANFGVPLAGSLIPWIDVDLGNGQSK
EEWKGGVETNKILGRSDNPTVIDGLCVRVGAMRCHSQAITLKLKKDLPVSEIETILAGAN
DWVKVIPNEKEASIHELTPAKVTGTLSVPVGRIRKLGMGGEYISAFTVGDQLLWGAAEPL
RRVLRIVLGSL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaggtttcgtcggctggcgcggtatggtcggttcggttttgatgcagcgtatg
aaagaagaaaacgacttcgcccacattcctgaagcgtttttctttaccacttccaacgtc
ggcggcgcagcccctgatttcggtcaggcggctaaaacattattagatgccaacaatgtt
gccgaactcgccaaaatggacatcatcgttacctgccaaggcggcgattacaccaaatcc
gtcttccaagccctgcgcgacagcggctggaacggctactggattgacgcggcgtcctca
ctgcgcatgaaagacgacgcgattatcgtcctcgaccctgtcaaccgcgatgtcctcgac
aacggtctcaaaaacggcgtgaaaaactacattggcggcaactgcaccgtttccctgatg
ctgatggctttgggcggcctgttccaaaacgatttggtcgaatgggcaaccagcatgacc
taccaagccgcttccggcgcgggcgcgaaaaacatgcgcgaactcatcagcggtatgggc
gcggttcacgcccaagtggcggacgcgcttgccgatcctgccggctcgattctcgacatc
gaccgcaaagtatccgatttcctgcgcagcgaagactatccgaaagccaacttcggcgta
ccgctcgccggcagcctgattccgtggattgacgtggatttgggcaacggccagtccaaa
gaagaatggaaaggcggcgtggaaaccaacaaaatcctcggccgcagcgacaatccaacc
gtgattgacggcctgtgcgtccgcgtcggcgcgatgcgctgccacagccaagccatcact
ctgaagttgaaaaaagacctgcctgtttccgaaatcgaaacgattttggcaggcgcgaat
gactgggtgaaagtcatccccaatgaaaaagaagccagcatccacgagctgactcctgcc
aaagttaccggcacgctgtccgtccctgtcggacgcatccgcaaactgggcatgggcggc
gaatacatcagcgcgttcaccgtcggcgaccaacttttgtggggcgctgccgaaccgctg
cgccgcgtattgcgtatcgtgttgggcagcctgtga

DBGET integrated database retrieval system