KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2079Help
Entry
NMB2079           CDS       T00027                                 

Gene name
asd
Definition
(RefSeq) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00260  Glycine, serine and threonine metabolism
nme00261  Monobactam biosynthesis
nme00270  Cysteine and methionine metabolism
nme00300  Lysine biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
nme_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB2079 (asd)
   00270 Cysteine and methionine metabolism
    NMB2079 (asd)
   00300 Lysine biosynthesis
    NMB2079 (asd)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    NMB2079 (asd)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     NMB2079 (asd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 903977
NCBI-ProteinID: NP_275068
UniProt: P30903
Position
2201514..2202629
Genome map
AA seq 371 aa AA seqDB search
MKVGFVGWRGMVGSVLMQRMKEENDFAHIPEAFFFTTSNVGGAAPDFGQAAKTLLDANNV
AELAKMDIIVTCQGGDYTKSVFQALRDSGWNGYWIDAASSLRMKDDAIIVLDPVNRDVLD
NGLKNGVKNYIGGNCTVSLMLMALGGLFQNDLVEWATSMTYQAASGAGAKNMRELISGMG
AVHAQVADALADPAGSILDIDRKVSDFLRSEDYPKANFGVPLAGSLIPWIDVDLGNGQSK
EEWKGGVETNKILGRSDNPTVIDGLCVRVGAMRCHSQAITLKLKKDLPVSEIETILAGAN
DWVKVIPNEKEASIHELTPAKVTGTLSVPVGRIRKLGMGGEYISAFTVGDQLLWGAAEPL
RRVLRIVLGSL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaggtttcgtcggctggcgcggtatggtcggttcggttttgatgcagcgtatg
aaagaagaaaacgacttcgcccacattcctgaagcgtttttctttaccacttccaacgtc
ggcggcgcagcccctgatttcggtcaggcggctaaaacattattagatgccaacaatgtt
gccgaactcgccaaaatggacatcatcgttacctgccaaggcggcgattacaccaaatcc
gtcttccaagccctgcgcgacagcggctggaacggctactggattgacgcggcgtcctca
ctgcgcatgaaagacgacgcgattatcgtcctcgaccctgtcaaccgcgatgtcctcgac
aacggtctcaaaaacggcgtgaaaaactacattggcggcaactgcaccgtttccctgatg
ctgatggctttgggcggcctgttccaaaacgatttggtcgaatgggcaaccagcatgacc
taccaagccgcttccggcgcgggcgcgaaaaacatgcgcgaactcatcagcggtatgggc
gcggttcacgcccaagtggcggacgcgcttgccgatcctgccggctcgattctcgacatc
gaccgcaaagtatccgatttcctgcgcagcgaagactatccgaaagccaacttcggcgta
ccgctcgccggcagcctgattccgtggattgacgtggatttgggcaacggccagtccaaa
gaagaatggaaaggcggcgtggaaaccaacaaaatcctcggccgcagcgacaatccaacc
gtgattgacggcctgtgcgtccgcgtcggcgcgatgcgctgccacagccaagccatcact
ctgaagttgaaaaaagacctgcctgtttccgaaatcgaaacgattttggcaggcgcgaat
gactgggtgaaagtcatccccaatgaaaaagaagccagcatccacgagctgactcctgcc
aaagttaccggcacgctgtccgtccctgtcggacgcatccgcaaactgggcatgggcggc
gaatacatcagcgcgttcaccgtcggcgaccaacttttgtggggcgctgccgaaccgctg
cgccgcgtattgcgtatcgtgttgggcagcctgtga

DBGET integrated database retrieval system