KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2090Help
Entry
NMB2090           CDS       T00027                                 

Gene name
gmhA
Definition
(RefSeq) phosphoheptose isomerase
  KO
K03271  
D-sedoheptulose 7-phosphate isomerase [EC:5.3.1.28]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB2090 (gmhA)
Enzymes [BR:nme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.28  D-sedoheptulose 7-phosphate isomerase
     NMB2090 (gmhA)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Unusual sugar
  NMB2090 (gmhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2211206..2211799
Genome map
AA seq 197 aa AA seqDB search
MTTLQERVAAHFAESIRAKQEAGKVLVEPTVQAAELMLQCLMNDGKILACGNGGSAADAQ
HFAAEMTGRFEKERMELAAVALTTDTSALTAIGNDYGFDHVFSKQVRALGRAGDVLVGIS
TSGNSANVIEAVKAAHERDMHVIALTGRDGGKIAAILKDTDVLLNVPHPRTARIQENHIL
LIHAMCDCIDSVLLEGM
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacgacattacaagaacgcgttgccgcccattttgccgaaagcatccgtgccaagcag
gaagccggaaaagtattggtcgagccgaccgtacaggctgccgagctgatgctgcaatgc
ctgatgaatgacggcaaaatcctggcctgcggcaacggcggttcggctgccgacgcgcaa
cacttcgccgccgaaatgaccggccgttttgaaaaagaacgcatggaactcgccgctgtc
gcgctgacaacagacacttccgcgctgacagccatcggcaacgactacggtttcgaccac
gtattcagcaaacaggtgcgcgcgctcggacgtgcaggcgatgtattggtcggcatttcc
acctccggcaattccgccaacgtcatcgaagccgtcaaagccgcacacgaacgcgatatg
cacgtcatcgccttgaccggccgcgacggcggcaaaatcgccgccatactcaaagacacc
gacgttttgctcaacgttccccatccgcgcaccgcccgtattcaagaaaaccacatcctg
ctgatacacgccatgtgcgactgtatcgactccgtactgctggaaggaatgtaa

DBGET integrated database retrieval system