KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2096Help
Entry
NMB2096           CDS       T00027                                 

Gene name
yojH
Definition
(RefSeq) malate:quinone oxidoreductase
  KO
K00116  
malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB2096 (yojH)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMB2096 (yojH)
   00620 Pyruvate metabolism
    NMB2096 (yojH)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     NMB2096 (yojH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2215184..2216650)
Genome map
AA seq 488 aa AA seqDB search
MAEATDVVLVGGGIMSATLGVLLKELEPSWEITLIERLEDVALESSNAWNNAGTGHSALC
ELNYAPLGANGIIDPARALNIAEQFHVSRQFWATLVAEGKLEDNSFINAVPHMSLVMNED
HCSYLQKRYDAFKTQKLFENMEFSTDRNKISDWAPLMMRGRDENQPVAANYSAEGTDVDF
GRLTRQMVKYLQGKGVKTEFNRHVEDIKRESDGAWVLKTADTRNPDGQLTLRTRFLFLGA
GGGALTLLQKSGIPEGKGYGGFPVSGLFFRNSNPETAEQHNAKVYGQASVGAPPMSVPHL
DTRNVDGKRHLMFGPYAGFRSNFLKQGSLMDLPLSIHMDNLYPMLCAGWANMPLTKYLLG
ELRKTKEERFASLLEYYPEANPDDWELITAGQRVQIIKKDSEKGGVLQFGTEIVAHADGS
LAALLGASPGASTAVPLMIRLMHQCFPERAPSWEDRLKELVPGYGIKLNENPERADEIIA
YTAKVLDI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgacagacgttgtcttggtgggcggcggcattatgagcgcgactttgggc
gttttgctcaaagaactcgaaccgtcttgggaaatcaccctgattgaacgcttggaagat
gtggcgttggaatcgtcaaacgcgtggaacaacgccggcacggggcattccgcgctgtgc
gaattgaactatgcgccgttgggtgcaaatgggattatcgatccggcgcgcgccctcaat
attgccgaacagtttcatgtcagccgccagttttgggcgacgctggtcgcggaaggcaag
ttggaagacaattccttcatcaatgccgtgccgcatatgtctttggtgatgaatgaagac
cattgttcttatcttcaaaaacgttatgacgcgtttaaaacccaaaaactttttgaaaat
atggaattttccaccgatcggaacaaaatttccgattgggctccgctgatgatgcgcggc
cgggacgaaaaccaacccgtcgccgccaactactccgccgaaggtacggatgtcgatttc
ggacggctgacgcgccaaatggtgaaatatttgcagggcaagggcgtaaaaaccgagttc
aaccgccacgtcgaagacatcaaacgcgaatccgacggcgcgtgggtgctcaaaaccgcc
gatacccgcaaccccgacgggcagctcaccctccgtacccgcttcctcttcctcggcgcg
ggcggcggcgcgctgaccctgctgcaaaaatccggcatccccgaaggcaaaggctacggc
ggcttccccgtgtccggcctgttcttccgcaacagcaaccccgaaaccgccgaacaacac
aacgccaaagtgtacgggcaggcttccgtcggcgcgccgccgatgtccgtcccgcacctc
gacacacgcaacgtggacggcaaacgccaccttatgttcggcccttacgcaggcttccgt
tccaacttcctcaagcaaggctcgcttatggatttgccgctgtccatccatatggacaac
ctctatcctatgctgtgcgccggctgggcgaatatgccgctgaccaaatacctgctgggc
gaattgcgtaaaaccaaagaagaacgcttcgcctccctgctggaatactaccccgaggca
aaccccgacgactgggaactcatcaccgcagggcaacgcgtccaaatcattaaaaaagac
tccgaaaaaggcggcgtgctccagtttggtacggagattgtcgcccacgccgacggctca
ctcgccgcattgctgggcgcgtcgccgggcgcatcgaccgctgtgccgctgatgatccgg
ctgatgcaccaatgcttccccgagcgcgccccgtcttgggaagaccgtctgaaagagctg
gtaccgggttacggcatcaagttgaacgaaaaccctgaaagggcggatgaaattatcgcc
tataccgcgaaagtattggatatttaa

DBGET integrated database retrieval system