KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2103Help
Entry
NMB2103           CDS       T00027                                 

Gene name
pyrH
Definition
(RefSeq) uridylate kinase
  KO
K09903  
uridylate kinase [EC:2.7.4.22]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB2103 (pyrH)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.22  UMP kinase
     NMB2103 (pyrH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2220831..2221550
Genome map
AA seq 239 aa AA seqDB search
MTQQIKYKRVLLKLSGESLMGSDPFGINHDTIVQTVGEIAEVVKMGVQVGIVVGGGNIFR
GVSAQAGSMDRATADYMGMMATVMNALALKDAFETLGIKARVQSALSMQQIAETYARPKA
IQYLEEGKVVIFAAGTGNPFFTTDTAAALRGAEMNCDVMLKATNVDGVYTADPKKDPSAT
RYETITFDEALLKNLKVMDATAFALCRERKLNIVVFGIAKEGSLKRVITGEDEGTLVHC
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcaaatcaaatacaaacgcgtattactgaaactctccggcgaatccctgatg
ggttccgatccgttcggcatcaatcacgataccatcgttcaaactgtcggcgaaattgcc
gaagtcgttaaaatgggcgtgcaagtcggtattgttgtcggcggcggcaatattttccgg
ggcgtatccgcccaagcaggcagcatggatcgcgccaccgccgactacatgggcatgatg
gcgaccgtgatgaacgcgttggcactcaaagacgcatttgaaactttaggcatcaaagcg
cgcgtacaatccgcactgtctatgcagcaaatcgctgaaacctacgcccgccccaaagcc
atccaatatttggaagaaggcaaagtcgtgatttttgccgccggtaccggtaacccgttc
ttcacgaccgacactgccgccgcattgcgcggtgcggaaatgaactgcgacgtgatgctc
aaagccaccaacgtcgacggtgtgtacaccgcagacccgaaaaaagacccgtccgccacg
cgctacgaaaccattacttttgacgaagccttgttgaaaaacctcaaagtcatggacgcg
accgctttcgccctctgccgcgaacgcaagctcaatattgtcgtcttcggcatcgccaaa
gaaggctcgctcaaacgcgtcattaccggcgaagacgagggaacgctggttcactgctga

DBGET integrated database retrieval system