KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2129Help
Entry
NMB2129           CDS       T00027                                 

Gene name
argG
Definition
(RefSeq) argininosuccinate synthase
  KO
K01940  
argininosuccinate synthase [EC:6.3.4.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB2129 (argG)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB2129 (argG)
   00220 Arginine biosynthesis
    NMB2129 (argG)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     NMB2129 (argG)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMB2129 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2236559..2237902
Genome map
AA seq 447 aa AA seqDB search
MSQNHTILQSLPVGQKVGIAFSGGLDTSAALLWMKLKGALPYAYTANLGQPDEDDYNAIP
KKAMEYGAENARLIDCRAQLAHEGIAAIQCGAFHVSTGGIAYFNTTPLGRAVTGTMLVSA
MKEDDVNIWGDGSTYKGNDIERFYRYGLLTNPALKIYKPWLDQQFIDELGGRHEMSEFLI
ANGFNYKMSVEKAYSTDSNMLGATHEAKDLEFLNSGIKIVKPIMGVAFWDENVEVSPEEV
SVRFEEGVPVALNGKEYADPVELFLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGM
ALFHIAYERLVTGIHNEDTIEQYRINGLRLGRLLYQGRWFDSQALMLRETAQRWVAKAVT
GEVTLELRRGNDYSILNTESPNLTYQPERLSMEKVEDAAFTPLDRIGQLTMRNLDITDTR
VKLGIYSQSGLLSLGEGSVLPQLGNKQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaaccataccattctgcaatccctccccgtcggtcagaaagtcggcatcgcc
ttctccggcggtcttgatacctctgccgcgctgttgtggatgaaactcaaaggcgcgctg
ccttatgcctacactgccaacctcggccagcccgacgaagacgactacaacgccattccc
aaaaaagcgatggaatacggtgcggaaaacgcccgcttaatcgactgccgcgcgcagttg
gcacacgaaggcatcgccgccatccaatgcggcgcgtttcacgtttccaccggcggcatc
gcctatttcaacaccacgcctctgggccgcgccgtaaccggcactatgcttgtttccgca
atgaaagaagacgatgtgaatatttggggcgacggcagcacctacaaaggcaacgacatc
gagcgtttctaccgctacggtttgctcaccaatcccgcgctgaaaatctacaaaccctgg
ctcgatcagcaatttatcgacgaactcggcggccgtcacgaaatgagcgaatttctgatt
gccaacggcttcaactacaaaatgtcggtggaaaaagcctactccaccgattccaatatg
ttgggtgccacccacgaagccaaagacttggaatttttgaactcgggcatcaaaatcgtc
aaacccattatgggcgttgccttttgggacgaaaacgtcgaagtcagcccggaagaagtc
agcgtacgctttgaagaaggcgtgccggttgcactaaacggcaaagaatacgccgatccc
gtcgaactcttcctcgaagccaaccgcatcggcggccgccacggcttgggtatgagcgac
caaatcgaaaaccgcatcatcgaagccaaatcgcgcggcatctacgaagccccgggtatg
gcgttgttccacatcgcctacgagcgtttggtcaccggcatccacaacgaagacaccatc
gaacaataccgcatcaacggcctgcgcctcggccgcctgctctaccaaggccgctggttc
gacagccaagccctgatgttgcgcgaaaccgcacaacgctgggttgccaaagccgttacc
ggcgaagttaccctcgaactgcggcgcggcaacgactactcaattctgaacaccgaatcg
cccaacctgacctaccaacctgaacgcctgagtatggaaaaagtcgaagacgctgcgttc
actccgctcgaccgcatcggacagctcacgatgcgcaacctcgacatcaccgacacccgc
gtcaaactgggtatctactcgcaaagcggtttgctctcgctgggcgaaggttcggtattg
ccgcagttgggcaataagcaataa

DBGET integrated database retrieval system