KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2151Help
Entry
NMB2151           CDS       T00027                                 

Gene name
purD
Definition
(RefSeq) phosphoribosylamine--glycine ligase
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Module
nme_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB2151 (purD)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     NMB2151 (purD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GARS_A GARS_N GARS_C CPSase_L_D2 ATPgrasp_Ter ATP-grasp_3 ATP-grasp RimK ATP-grasp_2 ATP-grasp_5 ATP-grasp_4 Dala_Dala_lig_C Corona_3
Motif
Other DBs
NCBI-GeneID: 903221
NCBI-ProteinID: NP_275136
UniProt: Q9JXA3
Position
complement(2261115..2262386)
Genome map
AA seq 423 aa AA seqDB search
MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNIDLTAHQDLIEFCRK
ENIVFTVVGPEAPLAAGIVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY
QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHAAIDDMLLDNKMGNAGA
RVVIEDFLQGEEASFIVMVDGNNVLPMATSQDHKRLLDGDKGLNTGGMGAYSPAPVVTPV
VYERAMNEIILPTVAGMKAEGHEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR
LNSDLSDLVEAAIDGKLDSVTAEWSPQTAVGVVLAAQNYPETPKKGDIISGLDAANQIGK
VFHAGTTANEKGDVLTNGGRVLCVVGLGDNVAQAKAKAYGALEKISFDGMQYRKDIADKA
INR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctggttatcggtaatggcggtcgcgaacacgcgctggcttggaaattggcg
cagtcgcctaaagtggaaacagtatttgttgcgcctggtaatgccggtacagcgattgaa
cccaagttgcaaaacatcgacttgactgcgcatcaggatttgattgaattctgtcgtaaa
gaaaatattgtttttaccgtcgtcggccctgaagcgcctttggcggcaggtattgtggat
gatttccgtgctgcaggactaaaaatattcggtccgacacaatatgcggcgcagttggaa
agttccaaagatttcgccaaagcatttatggcgaaatacaatattccgaccgcgcaatat
caaacctttgaaaacgccgatgccgcacatgattacgtcaatcagaaaggtgcgcctatc
gttatcaaagccgatggtttggcggcaggtaaaggcgtgattgtggcgatgactttggat
gaagcgcatgctgcgattgatgatatgctgctggacaacaaaatgggcaatgccggcgcg
cgtgttgtaattgaagatttcctgcaaggcgaagaagcgagttttatcgtcatggttgat
ggcaataatgtactgcctatggcaaccagccaagaccacaagcgtcttttagacggcgac
aaaggtctgaatacgggcggtatgggtgcgtacagccctgcgcctgtggtaacgcctgtt
gtgtacgaacgcgcgatgaatgaaattattttgccgaccgtagcagggatgaaagcggag
gggcatgagttcaccggtttcctgtacgcaggtttgatgattgatcaaagcggtgcaccc
tatacgattgagtttaactgccgtttcggcgatcctgaaacccagccgattatgagccga
ctgaacagcgacttatcggatttggttgaagcggcaatagacggcaaactcgatagcgta
accgcggaatggagcccgcaaactgccgtgggcgtggtactggcggcgcaaaattacccc
gaaacgcccaaaaaaggcgatattatttccggtctggatgctgccaaccaaatcggcaaa
gttttccatgcaggtacaacggcaaacgagaaaggtgacgtattgaccaacggcggacgc
gtattgtgtgttgtgggattgggcgataatgtggcgcaagcgaaagctaaggcatatggc
gcgttggaaaaaatcagtttcgacgggatgcaataccgtaaagacattgccgataaagcg
attaaccgttaa

DBGET integrated database retrieval system