KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2156Help
Entry
NMB2156           CDS       T00027                                 

Gene name
rfaC
Definition
(RefSeq) lipopolysaccharide heptosyltransferase I
  KO
K02841  
heptosyltransferase I [EC:2.4.-.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB2156 (rfaC)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     NMB2156 (rfaC)
Glycosyltransferases [BR:nme01003]
 Polysaccharide
  Bacterial polysaccharide
   NMB2156 (rfaC)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Core region
  NMB2156 (rfaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2265509..2266477)
Genome map
AA seq 322 aa AA seqDB search
MKILLVRLSSMGDLIHTLPAIEDLARQCPDVELHWLCEAGFADIARLHPFVKKIHVMKWR
QWRKHLFRAETWREMGHLKQTLRQEVFDFVLDSQGLIKSACFAKMAKSPICGLDKNSARE
GWAALAYVKTYAVPKGKNAVWRNRELFAQVFGYVMPETQVFGLTVPEAGRLKNLAQPYYA
ALHATSRDSKLWPVENWRSLLQKLNEEQQCNIYLPWGNEDEKTRAKQIADGLPFAIVCDK
INLLQAAYLLKYAVGIVGVDTGLLHLANALEKPVVGIYTDTDPIKTGVQVSPIAKNLGNI
GQIPTADLVYQALMDCVAADKG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttgcttgtccgcttgtctagtatgggcgatttaattcacactttgcccgca
atcgaagatttggcgcgacaatgtcctgatgtagaactgcattggctatgtgaggctgga
tttgcagatattgcgcgcctgcatccgtttgtaaaaaaaatccatgtgatgaaatggcgg
caatggcgcaaacatctctttcgggctgaaacttggcgggaaatgggtcatctgaaacag
actttgcggcaggaagtatttgatttcgtattggacagtcaaggtctgattaaaagcgcg
tgtttcgctaaaatggcaaaatccccgatttgtggtttggataaaaacagtgcgcgcgag
ggatgggctgctttggcgtatgtaaaaacatacgctgtaccgaagggaaaaaatgccgtt
tggcgcaaccgtgaactgtttgcccaagtatttgggtatgtaatgccggaaacgcaggta
tttggcttgactgttcctgaagcaggccgtctgaaaaatttagcgcagccgtattatgcg
gctttgcatgcgaccagtcgggacagtaagttatggcctgtggaaaactggcggtcgttg
ctgcaaaagttgaatgaagaacagcaatgcaatatttacctgccttggggaaatgaagat
gaaaaaacgcgtgccaaacaaattgcagatgggctgccgtttgctattgtgtgcgacaaa
ataaatttattgcaggcagcgtatctgctgaaatacgcggtcggaattgtcggcgtggat
accggtttgctgcatttggcaaatgccttggaaaaacctgtggtcggcatttataccgat
accgatccgattaaaacaggcgttcaggtttcgccaattgcaaaaaatttgggcaatatc
gggcagattccgaccgcagatttggtttatcaagcgctgatggattgtgttgcagcagat
aaaggctaa

DBGET integrated database retrieval system