KEGG   Natrialba magadii: Nmag_0023Help
Entry
Nmag_0023         CDS       T01176                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nmg  Natrialba magadii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nmag_0023
  Amino acid metabolism
   00340 Histidine metabolism
    Nmag_0023
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Nmag_0023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(24507..25814)
Genome map
AA seq 435 aa AA seqDB search
MTTDVREIADLGPDDRVAFFERDAGIESVRGDVREIVDRVREEGDVAIREFTSEFDGVEV
GNLEITDECERAYDELDPDLREAIETAAANVKEFHEAQIPEDWRREFSNGRELGRRFRPI
DRVGVYVPGGEAAYPSSAIMGVVPAVVAGVEHVSVVTPPADELNPATLAAIHIAGADAVY
SVGGAQAIAALAYGSESITRVQKVVGPGNKWVTAAKAAVRGDVEIDFLAGPSEIVVVADE
TADPTLVAAELVAQAEHDPNASVVAVTDDADTATAIADAVGEQANASEREDVIRQALEND
ASGVLLARSMSEAILFTEEYAPEHLSIIADDDESLLERIDSAGSVFLGPETPVAAGDYAS
GTNHVLPTNGGARVTGGLSVETFLRSTTVQRLSSDGLNELGETITTLADAEGLDAHANSV
RVRLDRSGAETVDDS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgacgtgcgcgaaatagctgatctcggtccggacgaccgggttgcttttttc
gagcgagatgcggggattgagagcgttcgcggggatgtacgagagattgtcgaccgcgtc
cgcgaggagggagacgtcgctatccgtgagttcacaagtgagttcgacggtgtcgaagtg
ggaaacctcgagataacggacgagtgtgagcgcgcgtacgacgagcttgatccggacctc
cgcgaagcaatcgaaaccgcagcggccaacgtcaaagagttccacgaagcgcagattcct
gaggactggcgacgcgagttcagcaacggacgtgaactgggtcgacgattccgaccgatc
gatcgcgttggcgtctatgtccccggcggggaagcagcatatccgtcgagtgcgatcatg
ggagtcgtcccggcggtcgtcgcaggcgttgagcacgtctccgttgtaacgccgccagcg
gatgaactgaacccagcgacactcgcggcaatccacatcgcgggtgcagacgcagtctat
agtgtcgggggcgcacaggcaattgcggctctcgcttacggaagcgaatccatcacgcgt
gtccagaaggtagtcgggccggggaacaagtgggtcaccgcagccaaggcagcggtccgc
ggtgacgtcgaaatcgactttttggccggtccgagcgaaatcgtcgtcgtcgccgacgag
actgccgatcccactctcgtcgcagctgagttagttgcgcaggcggaacacgatccaaac
gcttcggtcgtcgccgtgactgatgacgcagacacggcaacggcaatcgccgacgccgtc
ggcgagcaagccaacgcgagcgagcgcgaagatgtaattcgtcaggcactcgagaacgat
gccagtggcgtccttctggcacgctcgatgagcgaggccattctgttcacggaggagtac
gcgccagagcatctctcgatcattgcggacgacgacgagtcactgctcgagcgcatcgat
agcgcaggaagcgtcttcctgggtcctgaaacaccagtcgcggccggcgattacgccagt
gggacgaatcacgttctaccgacgaacggcggtgcacgcgtgactggtggactctccgtc
gagacgttccttcggtcgacgacagtgcagcgcctctcgtcggacgggctcaatgaactc
ggcgagacgatcacgacgctcgcggacgccgagggactcgacgcacacgccaacagcgtg
cgggtacgtctggatcggagcggagcggagacggtcgacgactcgtag

DBGET integrated database retrieval system