KEGG   Natrialba magadii: Nmag_0345Help
Entry
Nmag_0345         CDS       T01176                                 

Definition
alcohol dehydrogenase zinc-binding domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
nmg  Natrialba magadii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Nmag_0345
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_0345
  Lipid metabolism
   00071 Fatty acid degradation
    Nmag_0345
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nmag_0345
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Nmag_0345
   00626 Naphthalene degradation
    Nmag_0345
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Nmag_0345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(333726..334787)
Genome map
AA seq 353 aa AA seqDB search
MRAAVLEEHGAPLAVKEVDYPDPEPDQVIVETKACGICRSDWHAWQGDWSWIGASVPEGQ
ILGHEPAGVVSAVGEDVETLQEGDRVAVPFHLGDGTCSHCREGRANNCETVIPLGLSSIA
PGAFAEAFPVREADYNCVKLPDDVDFTEMAGLGCRFMTAYHALADRAGLRPGDWVAVHGC
GGVGLSAIHIADALGAHPIAVDVREDKLDRARELGASATVNAAEADNTAQEVKALAGGGA
DVSIDALGIAETCQNSIGSLGTRGTHVQVGLTTDEEEGQIEVPVDVMTMRELDFHGSFGM
PLVRYEELFRLIGEGTLEPSKIIGETLSLEEAPETLSSMDSYETVGIPVITEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagcagtactcgaagaacacggtgcaccgcttgcggtcaaagaggtcgactac
cccgatccggaaccggatcaggttatcgtcgagacgaaagcctgcgggatctgtcggagc
gactggcacgcctggcagggcgactggagctggatcggcgcttcggtgccggaggggcag
attctcggccacgagccagcaggggtcgtttccgcggtcggcgaagatgtcgagacactc
caggagggcgaccgcgttgcggtgccgttccacctcggcgatggcacctgctcacactgt
cgcgagggaagagcgaataactgcgagaccgtcatcccgctcggtctgtcgagtatcgcg
ccgggtgcgttcgccgaggccttcccggtccgcgaggcagactacaactgcgtgaagctc
cccgacgacgtcgacttcaccgagatggccggcctcggctgccggttcatgaccgcctac
cacgcgctcgcagaccgcgcaggccttcggcccggcgactgggtcgccgtccacggctgt
ggcggtgtcggcctttcggcaatccacatcgccgacgcgctgggtgcacacccgatcgca
gtcgacgttcgcgaggacaaactcgatcgcgcccgcgaactcggcgcgtccgcgacggtc
aacgcagccgaggccgacaacacggcacaggaggtcaaagcgctcgccggcggcggcgca
gacgtctcgatcgacgcgctcggtatcgctgagacctgccagaactcgatcggcagtctc
ggaacccgtggtacgcacgtccaggtcggcctgactaccgacgaagaggaagggcagatc
gaggttcccgtcgacgtgatgacgatgcgggaactcgacttccacggctcgttcggcatg
ccgctcgtccgctacgaggaactgttcaggctgatcggcgagggcacactcgagccgagc
aagatcatcggcgagacgctgtcactcgaggaggcccccgaaacgctgtcctcgatggat
agctacgagacggtcgggattccggtcatcaccgagttttga

DBGET integrated database retrieval system