KEGG   Natrialba magadii: Nmag_0545Help
Entry
Nmag_0545         CDS       T01176                                 

Definition
class I and II aminotransferase
Orthology
K00812  
aspartate aminotransferase [EC:2.6.1.1]
Organism
nmg  Natrialba magadii
Pathway
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Nmag_0545
   01230 Biosynthesis of amino acids
    Nmag_0545
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nmag_0545
   00270 Cysteine and methionine metabolism
    Nmag_0545
   00330 Arginine and proline metabolism
    Nmag_0545
   00350 Tyrosine metabolism
    Nmag_0545
   00360 Phenylalanine metabolism
    Nmag_0545
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nmag_0545
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Nmag_0545
Enzymes [BR:nmg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Nmag_0545
Amino acid related enzymes [BR:nmg01007]
 Aminotransferase (transaminase)
  Class I
   Nmag_0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(538351..539472)
Genome map
AA seq 373 aa AA seqDB search
MTEFATRVEDVSISGIREVFEAAGEDAINLGIGQPDFPTPDHVRQAAIEAIESGQVDAYT
SNKGISQLREAIATKYDRDYGIEVDPEHTMATSGGSEALHLALEAHVDPGQEVIFPDPGF
VSYDALTRFAGGTPKPLSLREDLTLDPAAVEEAITDETAAFIVNSPSNPTGAVQSEADMR
EFARIADEHDVLCISDEVYEHIVFEGEHHSPLKFAETDNVIVVSACSKTYSMTGWRLGWL
VGSGDRIDRMVRIHQYAQACASAPAQFAAEAALTGPQDPVDEMVAAFEERRDVVVDGLVD
AGLEVPTPSGAFYAMPKVPDGWCEEVLDRGVVVVPGDAFGANGAGYARLSYATSMEDLKD
ALEIMDDATSAVR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtttgcaacccgggtcgaggacgtgtcgatcagtggcatccgcgaagtgttc
gaggccgcgggcgaggacgcgatcaatctcggcatcggccaacccgatttcccgacgccg
gatcacgtccgccaggcggcgatcgaggctatcgaatcggggcaggtggacgcctacacg
tcgaacaaggggatcagccaacttcgagaagccatcgcaacgaagtacgaccgcgactac
ggcatcgaggtcgaccctgagcatacgatggctacctcgggcggcagcgaggcactccac
cttgcactcgaagcccacgtcgatccaggccaggaggttatcttcccagatcccggcttc
gtctcctacgacgcgctgacgcggttcgccggtggcacaccgaaaccgctctcactgcgc
gaggacctcactctcgatccggcggccgtcgaggaggccatcaccgacgagacagcggcg
ttcatcgtcaacagtccgtcgaacccgacgggggccgtccagagcgaagccgacatgcgg
gagttcgcgcggatcgccgacgaacacgacgtgctctgcatctccgacgaggtctacgaa
cacatcgtcttcgagggcgagcaccactcaccgctgaaattcgccgagacggacaacgtg
attgtcgtcagcgcctgctcgaagacgtactcgatgaccggctggcgactcggctggctc
gtcggctccggcgaccgaatcgatcgcatggttcggatccaccagtacgcccaggcctgt
gcctccgccccggcgcagttcgccgctgaggcggcgctgacagggccacaggatccggtc
gacgagatggtcgctgcgttcgaagaacgccgtgacgtggtcgttgacggcctcgtggac
gccggtctcgaggtcccgacgccgtcgggtgcgttctacgccatgccgaaggtccccgac
ggctggtgtgaggaagtgctcgaccgcggcgtcgtcgtcgtccccggcgacgccttcggc
gcgaacggcgcgggctacgcccgtctctcgtatgcaaccagcatggaagacctgaaggac
gcactcgagatcatggacgacgcgacgagcgcagttcggtag

DBGET integrated database retrieval system