KEGG   Natrialba magadii: Nmag_0603Help
Entry
Nmag_0603         CDS       T01176                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmg  Natrialba magadii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmag_0603
   01230 Biosynthesis of amino acids
    Nmag_0603
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_0603
   00051 Fructose and mannose metabolism
    Nmag_0603
   00562 Inositol phosphate metabolism
    Nmag_0603
Enzymes [BR:nmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nmag_0603
Exosome [BR:nmg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nmag_0603
  Exosomal proteins of bladder cancer cells
   Nmag_0603
  Exosomal proteins of melanoma cells
   Nmag_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(596266..596910)
Genome map
AA seq 214 aa AA seqDB search
MFVLVNLKTYPCDPVAVAEAVRDVNETTDARLAVAPQAAHLERVADTGAETWAQHVDPIE
HGSNTGHTLAESVANAGAVGTLINHSEQRLKLADIDGSVQAAERAGLETVVCANNPAQIG
AAAALGPDAVAVEPPALIGTGTPVSQADPDIVEDAVDAAESVDNDVSVLCGAGISTGDDV
VAASDLGSEGVLLASGVAKADDPTAALEDLVDPL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcctcgtcaacctgaagacgtatccgtgtgatccagtcgccgtcgcggaggcc
gtccgcgatgttaacgagactaccgacgctcgcctcgccgtcgcgccgcaggcagcacac
ctcgaacgcgtcgccgacaccggcgcagagacctgggcacagcacgtcgatccgatcgaa
cacgggagcaacaccggacacacgcttgcggagtccgtcgccaacgcaggtgcagtcggc
accctgatcaaccactccgagcagcgcctgaaactcgccgatatcgacggctcggtgcag
gcagcggagcgcgccggactcgagacggtcgtctgtgcgaacaacccagcacagatcggc
gcggccgcggcgctcggaccggatgccgtcgccgtcgaaccgccagcactgatcgggacg
ggaacgccggtcagccaggctgatccggatatcgtcgaggacgccgtggatgcagccgag
agcgtcgataacgatgtgtccgtgctctgcggtgcgggtatcagcacgggcgacgacgtg
gtcgctgccagcgacctcggctccgagggcgtcctgctcgcaagcggcgtcgcgaaggct
gacgatccgacggctgcacttgaggatctggtcgacccgctctga

DBGET integrated database retrieval system