KEGG   Natrialba magadii: Nmag_0603Help
Entry
Nmag_0603         CDS       T01176                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmg  Natrialba magadii
Pathway
nmg00010  Glycolysis / Gluconeogenesis
nmg00051  Fructose and mannose metabolism
nmg00562  Inositol phosphate metabolism
nmg01100  Metabolic pathways
nmg01110  Biosynthesis of secondary metabolites
nmg01120  Microbial metabolism in diverse environments
nmg01130  Biosynthesis of antibiotics
nmg01200  Carbon metabolism
nmg01230  Biosynthesis of amino acids
Module
nmg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nmg_M00002  Glycolysis, core module involving three-carbon compounds
nmg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_0603
   00051 Fructose and mannose metabolism
    Nmag_0603
   00562 Inositol phosphate metabolism
    Nmag_0603
Enzymes [BR:nmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nmag_0603
Exosome [BR:nmg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nmag_0603
  Exosomal proteins of bladder cancer cells
   Nmag_0603
  Exosomal proteins of melanoma cells
   Nmag_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS FMN_dh Hydrolase_like Glu_synthase
Motif
Other DBs
NCBI-ProteinID: ADD04189
UniProt: D3SYS8
Position
complement(596266..596910)
Genome map
AA seq 214 aa AA seqDB search
MFVLVNLKTYPCDPVAVAEAVRDVNETTDARLAVAPQAAHLERVADTGAETWAQHVDPIE
HGSNTGHTLAESVANAGAVGTLINHSEQRLKLADIDGSVQAAERAGLETVVCANNPAQIG
AAAALGPDAVAVEPPALIGTGTPVSQADPDIVEDAVDAAESVDNDVSVLCGAGISTGDDV
VAASDLGSEGVLLASGVAKADDPTAALEDLVDPL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcctcgtcaacctgaagacgtatccgtgtgatccagtcgccgtcgcggaggcc
gtccgcgatgttaacgagactaccgacgctcgcctcgccgtcgcgccgcaggcagcacac
ctcgaacgcgtcgccgacaccggcgcagagacctgggcacagcacgtcgatccgatcgaa
cacgggagcaacaccggacacacgcttgcggagtccgtcgccaacgcaggtgcagtcggc
accctgatcaaccactccgagcagcgcctgaaactcgccgatatcgacggctcggtgcag
gcagcggagcgcgccggactcgagacggtcgtctgtgcgaacaacccagcacagatcggc
gcggccgcggcgctcggaccggatgccgtcgccgtcgaaccgccagcactgatcgggacg
ggaacgccggtcagccaggctgatccggatatcgtcgaggacgccgtggatgcagccgag
agcgtcgataacgatgtgtccgtgctctgcggtgcgggtatcagcacgggcgacgacgtg
gtcgctgccagcgacctcggctccgagggcgtcctgctcgcaagcggcgtcgcgaaggct
gacgatccgacggctgcacttgaggatctggtcgacccgctctga

DBGET integrated database retrieval system