KEGG   Natrialba magadii: Nmag_0607Help
Entry
Nmag_0607         CDS       T01176                                 

Definition
(GenBank) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
nmg  Natrialba magadii
Pathway
nmg00340  Histidine metabolism
nmg00350  Tyrosine metabolism
nmg00360  Phenylalanine metabolism
nmg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmg00401  Novobiocin biosynthesis
nmg01100  Metabolic pathways
nmg01110  Biosynthesis of secondary metabolites
nmg01130  Biosynthesis of antibiotics
nmg01230  Biosynthesis of amino acids
Module
nmg_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Nmag_0607
   00350 Tyrosine metabolism
    Nmag_0607
   00360 Phenylalanine metabolism
    Nmag_0607
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nmag_0607
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Nmag_0607
Enzymes [BR:nmg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     Nmag_0607
Amino acid related enzymes [BR:nmg01007]
 Aminotransferase (transaminase)
  Class II
   Nmag_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Alliinase_C HTH_38
Motif
Other DBs
NCBI-ProteinID: ADD04193
UniProt: D3SYT2
Position
complement(598933..600132)
Genome map
AA seq 399 aa AA seqDB search
MQPRDLSDHVAYEAGRGIEEVARELGRDPSEFVKLASNENPHGPSPAAVETIREAASTVS
SYPKSTHTDLTEAVADHWDISPAQVWLANGGDGALDYLSRAVIEPGDEVLVPTPGFAYYG
MSARFHHGEVSEYSLDREDGFAQTAQAVLEDYDGERIVYLTSPHNPSGSTIDLAEIERLA
DETDEETLVVVDEAYGEFADVESAIALIEGRDGFDSRDDIAVLRTFSKAYGLAGLRLGYA
VVPDEWADAYTRVNTPFAASELACRAGLAAFGDDKHVERTVETARKSRTAMREDIDAHVW
ESEGNFALAAVGDASTVAETMQERGVIVRDCTSFGLPGCIRITCGTEAETERAIETLNEV
LADLGLDLDSDSDSDSDSEPNPNSDSGPAADHEREVSDT
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgcgcgatctgtccgatcacgtcgcctacgaggcgggtcggggcatcgaggaa
gtcgcccgcgaactcgggcgcgatccctcggagttcgtcaaactcgcctcgaacgagaac
ccgcacggaccctcgccggccgccgtcgagactatccgcgaggcagcctcgaccgtcagt
tcctacccgaaatcaacacacactgacctcaccgaagccgtcgccgaccactgggacatc
tcacccgcacaggtctggctggcaaacggtggcgacggggcactcgattacctctcacgg
gccgtcatcgaacccggcgacgaggtgctcgttccgacgcccggattcgcctactacggt
atgagcgcccgcttccaccacggcgaggtcagtgagtacagcctcgaccgcgaggatgga
ttcgcccagaccgcacaggcagttctcgaggactacgacggcgaacggatcgtctatctc
accagcccgcacaacccgtcggggtcgacgatcgacctcgccgaaatcgagcgcctggca
gacgaaaccgacgaggagacgctcgtcgtcgtcgacgaggcctacggcgagttcgccgac
gtcgagagcgccatcgcacttatcgagggccgagacggcttcgattcgcgggacgatatc
gccgtcttgcggacgttctcgaaggcctacggcctcgccggcctccgactcggctacgcc
gtggttcccgacgagtgggcagacgcctacacgcgcgtgaacacgcccttcgccgcgagc
gaactcgcctgccgggccgggctggccgccttcggcgacgacaaacacgtcgagcggacc
gtcgagacggcacgcaagtcccgcacggccatgcgtgaggatatcgatgcgcacgtctgg
gagagcgaggggaacttcgccctcgcagctgtgggcgacgccagtacggtcgccgagacg
atgcaggaacgtggcgtcatcgtccgggactgtacgagcttcgggctacccggctgtatc
cgcatcacctgcggcaccgaggccgaaaccgagcgcgcgatcgagacgctcaacgaggtg
ctcgcggatctcggtctggatctcgattccgattccgattccgattccgattccgaaccc
aatcccaattctgattccggtcccgcagccgaccacgaacgtgaggtgtccgacacgtga

DBGET integrated database retrieval system