KEGG   Natrialba magadii: Nmag_0612Help
Entry
Nmag_0612         CDS       T01176                                 

Definition
(GenBank) aldo/keto reductase
  KO
K06222  
2,5-diketo-D-gluconate reductase B [EC:1.1.1.346]
Organism
nmg  Natrialba magadii
Brite
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.346  2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming)
     Nmag_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
606611..607417
Genome map
AA seq 268 aa AA seqDB search
MSSQSPQLPQPGLGTSGHEGESCTDAVVTALESGYRHIDTAQMYDNEEAVGRALEQADID
REDVFLATKVHPSNLAAEDVLESTRESLDRLGVDTVDLLYVHWPMGEYDAEETLPAFDEA
VEVGLTRHVGVSNFTPDLLEEAVSMLDAPVVAHQIELHPELQQDELVSLGREHDIQTVAY
CPIAKADVAEIGVLQEIADDHDATPIQVALAWHYDRESVVPIPKGTGEHIHENYEAREIE
LTDDDRDRIDDLDAGERLVDPDDAAWNR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcacagtcaccacaactcccgcaaccgggtctcggcacctccggccacgaaggc
gagtcgtgtaccgacgccgtcgtcaccgcactcgagtccggctaccgtcacatcgacacc
gcacagatgtacgacaacgaggaagccgtcggtcgcgcgctcgaacaggccgacatcgac
cgcgaggacgtcttcctcgcgacgaaggttcacccgtcgaatctggctgcggaggacgta
ctcgagtccacccgtgaaagtctcgaccgactcggcgtcgacacggtcgacctgctctac
gtccactggccgatgggggagtacgacgccgaggagacgctgccggcgttcgacgaggcc
gtcgaggtgggactgacgcgccacgttggcgtgagtaacttcacgccggaccttctcgag
gaggccgtctccatgctcgatgctccggtcgtggctcaccagatcgaactccatcccgaa
ctgcagcaggacgaactcgtttcgctcggccgcgagcacgacattcagacggtcgcgtac
tgcccgatcgccaaggctgatgtcgcagagatcggcgttctgcaagagatcgccgacgac
catgacgcgacgccgattcaggtcgcgctggcgtggcactacgaccgcgagagtgtcgtt
ccgattccgaaggggacgggcgagcacatccacgagaactacgaggcgcgcgagatcgag
ttgacggacgacgaccgcgaccggatcgacgacctcgatgcgggtgagcgactggtcgat
ccggacgacgcggcctggaatcggtag

DBGET integrated database retrieval system