KEGG   Natrialba magadii: Nmag_0614Help
Entry
Nmag_0614         CDS       T01176                                 

Definition
(GenBank) dihydropyrimidine dehydrogenase
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
608551..609291
Genome map
AA seq 246 aa AA seqDB search
MFSPPLALASLSGESDADWARSGADYAGCAFLGGIAIDDRSRAAARELVARDRTEFLPDD
PLTFVDRQLQALEPESTPIQPAVNVRSATREPIRDVAQVCHEHDALLEINAHCRQDELCA
VGCGETLLADTDRLAGYVETAASTSAAVGVKVRAEVPGVELPVLAGVLESAGASFVHVDA
MDTESVIAEIADATDLFVIANNGVRDEETVREYVEYGADAVSVGRPSDNPVVLERVHDAV
VAQLES
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttctccccaccgctcgccctcgccagtttgagcggcgaatccgacgccgactgggcc
cgttccggtgccgactacgccggctgtgctttcctcggcgggatcgccatcgacgaccga
tcgagagccgccgcgcgcgaactcgtcgcccgcgaccgaaccgagttcctccccgacgac
cccctcacgttcgtcgaccgccagcttcaggcactcgaacccgagtccaccccgatccag
ccggcggtcaacgtccgcagcgcgacccgggaaccgatccgcgacgtggctcaggtctgt
cacgagcatgacgcactgctcgaaatcaacgcccactgccgacaggacgaactgtgcgcc
gtcggctgcggtgagacgctcctcgcggacacggatcgcctggcgggctacgtcgaaacg
gcagccagcaccagcgcagccgtcggtgtgaaggtccgcgccgaagtccccggtgtcgag
ttgcctgtgttggcgggtgtactcgagtctgccggtgcgtcgttcgtccacgtcgacgcg
atggatacggagtcggtcatcgccgagattgcggacgccacggacctcttcgtaatcgcg
aacaacggcgtccgtgacgaggagacggttcgggagtacgtcgagtacggtgcggatgcg
gtgagtgtgggtcggccgagtgacaatcctgttgtactcgagcgggtccacgatgcggtg
gtggcgcagttggagtcgtga

DBGET integrated database retrieval system