KEGG   Natrialba magadii: Nmag_0615Help
Entry
Nmag_0615         CDS       T01176                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
609479..609802
Genome map
AA seq 107 aa AA seqDB search
MTLDELSEEMQESYSEVGEELTVSLDRETRNELAMLETALEPDETDELVRRAIHMLFQST
VETGTMDFHLRSGFDVTYDEYLSGMTFDEMTGANQYPTMDDERRYQF
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgacgaactctccgaggagatgcaggaatcgtacagcgaggttggggaggaa
ctcaccgtctcgctcgaccgcgagacgcgaaacgaactcgccatgctcgagacggcactc
gagccggacgaaaccgacgaactcgttcgccgagcgattcacatgctctttcagtcgacc
gtcgagacgggaacgatggacttccacctgcgctcgggcttcgacgtaacctacgacgaa
tatctctcggggatgacgttcgacgagatgacgggtgcgaatcagtatccgacgatggac
gacgagcgccggtatcagttctga

DBGET integrated database retrieval system