KEGG   Natrialba magadii: Nmag_0634Help
Entry
Nmag_0634         CDS       T01176                                 

Definition
(GenBank) Bacterio-opsin activator HTH domain protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(627108..628118)
Genome map
AA seq 336 aa AA seqDB search
MSVIATIAVPATAFPLGSVLDSAGAHDTTVSIETTIPTSEGVLPYLWVPADIAPSIITTL
ESRSMVAGVSIIDEFDDTVLVEIEWATSVNGILKSIQESDVLVTNATGTAEQWTFRLRFP
SYDSLSTFYTACVDREIPIELLQLHEAVSAGDDQRFGLTTAQRELIVAAYEAGYFDIPRE
TTLVELGHELGISDSAVSQRLRRGLSTLIGSTLAIDPHHTQGEDSGRSSTSAPSRGSSVG
GGGERSVSENSGEDGRTAKERGNESERPSRKGAEGRDEYEYEYEHEPGCEYEYNDESTST
VEDDDADTADEPDTTASDAADENDGPELQTDGSNES
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttatcgccaccatcgccgtcccggcaacagcgttcccgcttggatccgtcttg
gactctgctggcgcacacgatacgaccgtctccatcgaaacgacaatcccgacgagcgaa
ggggtgcttccctacctctgggtccccgctgacatcgccccttccatcatcacgacactc
gagtcccggtcgatggtcgccggtgtctcgatcatcgacgagttcgacgacaccgtcctc
gtcgaaatcgagtgggcaacgagcgtcaacgggattctcaaatcgatccaggagagtgac
gtgctcgtgacgaacgccacggggactgccgaacagtggacgttccgccttcgcttcccc
tcctacgactcactatcaacgttctacaccgcctgtgtcgatcgcgaaatcccgatcgaa
ctgctccagctccacgaagccgtcagcgcaggcgacgaccagcgctttggccttacgact
gcccagcgcgagttgatcgtcgctgcctacgaggccggctacttcgacatcccacgagag
acaacgctcgtggaactcggacacgaactcggcatctccgactctgccgtctctcagcga
ctccggcgcggcctctcgacgctgatcggctcgacgctggcgatcgatccacaccacacc
cagggcgaggactcggggcgctcgagtacgagtgcaccgagtcgcggttcgagtgttggt
gggggtggagagagaagtgtgagtgagaatagcggtgaagatggaaggacggctaaagag
cgaggcaacgagtcagaaaggccatcgagaaagggagcggagggccgggatgagtatgag
tacgaatacgagcacgagcccgggtgcgaatacgagtacaacgacgaatcgacgtcaaca
gtcgaagacgacgacgcagacactgcagacgaaccagacacgacagcgtccgacgccgca
gacgaaaacgacggtcctgaactccagacggacggatcgaacgagtcgtga

DBGET integrated database retrieval system