KEGG   Natrialba magadii: Nmag_0637Help
Entry
Nmag_0637         CDS       T01176                                 

Definition
(GenBank) peptidase M24
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
630023..631177
Genome map
AA seq 384 aa AA seqDB search
MDKRERLDDYLERNELESVWFARPNAFAWLTGGNSVVDRETPTGVAVAGYDGDDVRIVTT
NNEANRIEDEELPDLDTDAVSVEQFGWQTDSLAKAVAARVGKDERAAADIDVPGLERVDP
TPLRQPLTEQDQERYRRLGRETAAAVESVCRELRTGDSEHEVASALRVALSARNIEAPVI
LVGGSERAQRYRHYTPTDAELGDYALVSVTTERAGLHASCTRTVAFDAPEWLTERHEAAA
RVETTALAATRKAASTGGTAGDVFTAIQDAYDEVGYPDEWMEHHQGGAAGFSGREWIATP
GHEASVVEPMAYAWNPTIEGAKSEDTVLLADGEFEVLTATDNWPTTTVEAVASAGDAALG
NGTGDEYSLELELELERPAVLELD
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacgcgagcgactggacgactacctcgagcgcaacgaactcgagtcggtctgg
ttcgcccggccgaacgccttcgcctggctgaccggtggcaacagcgtcgtcgaccgggag
acgccaaccggcgtggccgttgccggctacgatggcgacgacgtgcgaatcgtgacgacg
aataacgaagcgaaccgaatcgaggacgaggagctaccggacctcgacacggacgccgtc
tccgtcgagcagttcggctggcaaaccgactcactcgccaaggcagtcgccgctcgcgtc
ggtaaggacgagcgcgccgctgccgacatcgacgtacccggactcgagcgagtggatccg
acgccgctccggcagccactgaccgaacaggaccaggagcgctaccgccgtctcggtcgc
gaaaccgccgctgccgtcgagtccgtctgccgagagttgcggacgggcgatagcgaacac
gaggtcgcctccgccctgcgcgtggcgctctcggcgcggaacatcgaagcccccgtcatc
ctcgtcggcggctccgagcgcgcacagcgctatcgccactacacaccgaccgacgccgaa
ctcggtgactacgcgctcgtctcggtgacgaccgagcgggccggtctccacgcaagttgt
acccggactgtcgcgttcgacgcacccgagtggctgaccgagcgccacgaggccgctgca
cgcgtcgagacaaccgcgctcgccgcgacgcggaaggccgcttcgacgggcggcacggcc
ggcgacgtgtttaccgcgattcaggacgcctacgacgaggtcggctatcccgatgaatgg
atggaacatcaccagggcggcgctgccggcttctccggccgcgagtggattgcaacgccc
ggccacgaggcgagcgtcgtagagcccatggcctacgcctggaatccgacgatcgagggc
gcgaaaagcgaagatactgtgttgctcgctgatggcgagttcgaggtactgaccgcgacc
gataactggccgacgacgacggtggaagctgttgcgtccgctggcgacgcagcgctcgga
aatggaactggggacgaatactccctcgaactcgaactcgaactcgaacgtccagccgta
ctcgagttagactga

DBGET integrated database retrieval system